DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CRIF and Gadd45gip1

DIOPT Version :9

Sequence 1:NP_649333.1 Gene:CRIF / 40395 FlyBaseID:FBgn0037102 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_899202.3 Gene:Gadd45gip1 / 102060 MGIID:1914947 Length:222 Species:Mus musculus


Alignment Length:180 Identity:56/180 - (31%)
Similarity:88/180 - (48%) Gaps:32/180 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 PHS----------WIHLTEKYQRQAFGRYGAQSNVNPKICFDSHGEKDSRQVMQLE--------T 115
            |||          | .||.:|..:.|||:||.|.|.|...:.:     ..|:.:||        :
Mouse    37 PHSPDPENLLTPRW-QLTPRYVAKQFGRHGAISGVPPASLWPT-----PEQLRELEAEEQEWYPS 95

  Fly   116 LLKMLEKNRAQKAEELARINAREEDIAKKMEKLTQ----WKADLHAKIAKREADAAAAIQRKERL 176
            |..|.|..|.|:....||..|||:.||:.|.|:.|    |:.....:..|.:||.    :|:.||
Mouse    96 LATMQESLRLQQQALEARRQAREQRIAECMAKMPQMIENWRKQKRERWEKIQADK----ERRARL 156

  Fly   177 VEEVRRHFGFKVDTRDERFKEMLEQKEKEDKKKQKEAKRKAKEEKMMAKL 226
            ..|.:...|:.||.|..||:|:|:..:|:.:|:.||.:::.|:|..:|.:
Mouse   157 QAEAQERLGYHVDPRSARFQELLQDLDKQQRKRLKEERQRQKKEARIAAM 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CRIFNP_649333.1 CR6_interact 29..231 CDD:287157 56/180 (31%)
Gadd45gip1NP_899202.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..47 3/9 (33%)
CR6_interact 42..211 CDD:287157 53/175 (30%)
Nuclear localization signal. /evidence=ECO:0000255 184..200 5/15 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..222 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847185
Domainoid 1 1.000 75 1.000 Domainoid score I9041
eggNOG 1 0.900 - - E1_KOG4848
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5256
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007222
OrthoInspector 1 1.000 - - oto93841
orthoMCL 1 0.900 - - OOG6_109424
Panther 1 1.100 - - LDO PTHR31761
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5556
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.780

Return to query results.
Submit another query.