DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CapaR and Olr630

DIOPT Version :9

Sequence 1:NP_996140.1 Gene:CapaR / 40393 FlyBaseID:FBgn0037100 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001001059.1 Gene:Olr630 / 405947 RGDID:1333510 Length:312 Species:Rattus norvegicus


Alignment Length:325 Identity:62/325 - (19%)
Similarity:131/325 - (40%) Gaps:71/325 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 VLITIIFGGIFITGVVGNLLVCIVIIRHSAMHTATNYYLFSLAVSDLLY-------LLFGLPTE- 125
            ||..::|...:|...:||:|:.:.|.....|.....::|..|::.||.|       ||..|..| 
  Rat    20 VLCFVLFLFCYIAIWMGNVLIMVSITCTQLMDQPMYFFLHYLSLCDLCYTSTVTPKLLTDLLAER 84

  Fly   126 -VFLYWHQYPDLFGMPFCKIRAFISEACTYVSVFTIVAFSMERFLAICHPLHLYAMVGFKRAIRI 189
             :..|.:          |..:.|:......:.:|.:.|.:.:|::|||.|||...::..:|...:
  Rat    85 KIISYNN----------CMTQLFLLHLLGAIEIFILTAMAYDRYVAICRPLHYTVIMSRQRCNEL 139

  Fly   190 ITALWIVSFISAIPFGLLSDIQYLNYPLDHSRIEESAFCSMSPKI------VNEIPVFEV----- 243
            :.......|:.:....||  |.:::: ..|:.|:. .||.:.|.:      ...|.:|.:     
  Rat   140 LAVCCTGGFVHSASQSLL--IAFVSF-CHHNEIDH-YFCDVYPLLKLACTDTQRIGLFVIVDSGL 200

  Fly   244 SFCIFFVIPMILIILLYGRMG---AKIRSRTNQKLGVQQGTNNRETRNSQMRKKTVIRMLAAVVI 305
            ...:.||:.|:...|:...:.   |:.||:.....|..                      ..:|:
  Rat   201 IALVTFVVLMVSYFLILHTISVYPAESRSKALSTCGSH----------------------ITIVV 243

  Fly   306 TFFVCWFPFHLQRLIFLYAKNMDNYLDINEALFSIAGFAYYVSCTVNPIVYSVMSRRYRVAFREL 370
            .|||        .::|:|.:....:.:  :.:|::  |...::...||::|::.:...:.|.:::
  Rat   244 LFFV--------PVVFIYIRPNTTFPE--DKVFAL--FYTIIAPMFNPLIYTLRNLEMKCAIKKI 296

  Fly   371  370
              Rat   297  296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CapaRNP_996140.1 7tm_4 85..374 CDD:304433 58/309 (19%)
7tm_1 85..356 CDD:278431 56/293 (19%)
Olr630NP_001001059.1 7tm_4 26..296 CDD:304433 60/317 (19%)
7tm_1 36..282 CDD:278431 56/293 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.