DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CapaR and Olr131

DIOPT Version :9

Sequence 1:NP_996140.1 Gene:CapaR / 40393 FlyBaseID:FBgn0037100 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001001285.1 Gene:Olr131 / 405071 RGDID:1333394 Length:307 Species:Rattus norvegicus


Alignment Length:319 Identity:70/319 - (21%)
Similarity:140/319 - (43%) Gaps:54/319 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 ITIIFGGIFITGVVGNLLVCIVIIRHSAMHTATNYYLFSLAVSDLLYLLFGLPTEVFLYWHQYPD 135
            |:|.|..|:|:.::||..:..:|.....:|....|:|..||.:||...|..:||.:.:.|..:.:
  Rat    25 ISIPFFAIYISVLLGNGTLLYLIKDDHNLHEPMYYFLAMLAGTDLTVTLTTMPTVMAVLWVNHRE 89

  Fly   136 L-FGMPFCKIRAFISEACTYVSVFTIVAFSMERFLAICHPLHLYAMVGFKRAIRIITALWIVSFI 199
            : .|.  |.::|::..:.:.|....::|.|.:||:|||.|||..:::...|.:.|...:.:..|:
  Rat    90 IRHGA--CFLQAYVIHSLSIVESGVLLAMSYDRFVAICTPLHYNSILTNSRVMTIGLGVVLRGFL 152

  Fly   200 SAIPFGLLSDIQYLNYPLDHSRIEESAFC--------SMSPKIVNEI-PVFEVSFCIFFVIPMIL 255
            |.:|    ..:....:|..||.:...|||        :.:....|:| ||  |...:.|.:..::
  Rat   153 SLVP----PILPLFWFPYCHSHVLSHAFCLHQDVMKLACADITFNQIYPV--VLVALTFFLDALI 211

  Fly   256 IILLYGRMGAKIRSRTNQKLGVQQGTNNRETRNSQMRKKTVIRMLAAVVITF-------FVCWFP 313
            |:..|..:...:       :|:..|....:..|      |.:..::.|::.:       |:..|.
  Rat   212 IVFSYVLILKTV-------MGIASGEERAKALN------TCVSHISCVLVFYITVIGLTFIHRFG 263

  Fly   314 FHLQRLIFLYAKNMDNYLDINEALFSIAGFAYYVSCTVNPIVYSVMSRRYRVAFRELLC 372
            .|...::         ::.::...|....|       :|||:||:.::..:.:...|||
  Rat   264 KHAPHVV---------HITMSYVYFLFPPF-------MNPIIYSIKTKHIQRSILRLLC 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CapaRNP_996140.1 7tm_4 85..374 CDD:304433 65/305 (21%)
7tm_1 85..356 CDD:278431 60/287 (21%)
Olr131NP_001001285.1 7tm_4 29..306 CDD:304433 66/313 (21%)
7tm_1 39..290 CDD:278431 60/287 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.