DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CapaR and Olr634

DIOPT Version :9

Sequence 1:NP_996140.1 Gene:CapaR / 40393 FlyBaseID:FBgn0037100 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001000647.1 Gene:Olr634 / 404843 RGDID:1333053 Length:313 Species:Rattus norvegicus


Alignment Length:320 Identity:56/320 - (17%)
Similarity:124/320 - (38%) Gaps:61/320 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 VLITIIFGGIFITGVVGNLLVCIVIIRHSAMHTATNYYLFS-LAVSDLLYLLFGLPTEV--FLYW 130
            |...:.|...::..:.|||:: ::.:|.|::.....||..| |:..|:.|.....|..:  .|..
  Rat    23 VFCFLFFSFCYLAILSGNLMI-LISVRCSSLFNQPMYYFLSHLSSMDICYTSCVTPKLIGDLLVR 86

  Fly   131 HQYPDLFGMPFCKIRAFISEACTYVSVFTIVAFSMERFLAICHPLHLYAMVGFKRAIRIITALWI 195
            .:|   .....|.::.........:.|..:.|.:.:|.:|||.|||...::...:...:|...|:
  Rat    87 RKY---ISFTNCMLQVIAMHFFGLIEVLILAAMAFDRCVAICKPLHYMLIMSRSKCHVLILVSWV 148

  Fly   196 ---------VSFISAIPFGLLSDIQYLNYPLDHSRIEESAFCSMSPKIVNEIPVFEVSFCIFFV- 250
                     ...:..:||...::|       ||      .:|.:.|.:  ::...:.:.....| 
  Rat   149 GGAAHSFSQFCLLICLPFCGTNEI-------DH------YYCDIFPLL--KVACTDTTIAGILVV 198

  Fly   251 -----IPMILIILLYGRMGAKIRSRTNQKLGVQQGTNNRETRNSQMRKKTVIRMLAAVVITFFVC 310
                 |.::..:||:|.....:.:..|.         :.|.|:..:  .|....:..|::.|..|
  Rat   199 ANSGLIALVTFVLLFGSYVVILFTLRNY---------SAEGRHKAL--STCGSHITVVILFFGPC 252

  Fly   311 WFPFHLQRLIFLYAKNMDNYLDINEALFSIAGFAYYVSCTVNPIVYSVMSRRYRVAFREL 370
                     ||.|.:....:.:  :.:|::  |...::...||::|::.:...:.|.:::
  Rat   253 ---------IFAYLRPPTTFPE--DKIFAL--FYTIIAPMFNPLIYTLRNTEMKKAIKKV 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CapaRNP_996140.1 7tm_4 85..374 CDD:304433 54/304 (18%)
7tm_1 85..356 CDD:278431 52/288 (18%)
Olr634NP_001000647.1 7tm_4 29..303 CDD:304433 55/314 (18%)
7tm_1 39..285 CDD:278431 52/288 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.