DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CapaR and Olr1653

DIOPT Version :9

Sequence 1:NP_996140.1 Gene:CapaR / 40393 FlyBaseID:FBgn0037100 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001000104.1 Gene:Olr1653 / 290957 RGDID:1334058 Length:315 Species:Rattus norvegicus


Alignment Length:364 Identity:73/364 - (20%)
Similarity:135/364 - (37%) Gaps:100/364 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 EFVAFVL----GPQTLPLYKAVLITIIFGGIFITGVVGNLLVCIVIIRHSAMHTATNYYLFSLAV 112
            |::.|:|    ..|.|    ..|...:|..:::..:|||||:..|......:.:...::|.:|::
  Rat    10 EYMEFLLMGYPDEQVL----QTLCATLFFLLYLAALVGNLLIITVTTVDKHLQSPLYFFLKNLSL 70

  Fly   113 SDLLYLLFGLPTEVFLYWHQYPDLFGMPF--CKIRAFISEACTYV---SVFT-IVAFSMERFLAI 171
            .|:.|:...:|..:.   :...:...:.|  |.::.|    |...   |.|. ::..|.:|:.||
  Rat    71 IDICYISVTVPKSIM---NSATNTHSITFLGCVLQVF----CVIFLAGSEFALLLVMSYDRYAAI 128

  Fly   172 CHPLHLYAMVGFKRAIRIITALWIVSFISAIPFGLLSDIQYLNYPLDHSRIEESAFCSMSPKIV- 235
            |.|||..|::.....::::.|.|    :|...:|.:......:.......:....||.: |.:: 
  Rat   129 CFPLHYEAIMSKDACVQMVAAAW----LSGCVYGSVHATGTFSVRFCGPNVVYQFFCDI-PSLLR 188

  Fly   236 -----NEI--PVFEVSFCIFFVIPMILIILLYGRMGAKIRSRTNQKLGVQQGTNNRETRNSQMRK 293
                 :||  .||.::.|.|..:..||:::.|                |...|......::|.|.
  Rat   189 LACFGDEILEYVFIITSCCFAFVCFILMVISY----------------VHIFTIILRIPSTQGRF 237

  Fly   294 KTVIRMLAAVVITFFVCWFPFHLQRLIFLYAKNMDNYLDINEALFSIAGFAYYVSCT-------- 350
            |           ||..| .| ||..:                .||..:||..|:..|        
  Rat   238 K-----------TFSTC-VP-HLTVV----------------TLFLSSGFVAYLGSTAKSPSSLN 273

  Fly   351 -------------VNPIVYSVMSRRYRVAFRELLCGKAV 376
                         :||::||..:...:||...:...|.:
  Rat   274 VFMSVFYSLLPPSLNPVIYSFRNSDVKVALHNIFGEKMI 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CapaRNP_996140.1 7tm_4 85..374 CDD:304433 64/323 (20%)
7tm_1 85..356 CDD:278431 60/305 (20%)
Olr1653NP_001000104.1 7tm_4 43..310 CDD:304433 64/323 (20%)
7tm_1 43..292 CDD:278431 60/305 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.