DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CapaR and Olfr1189

DIOPT Version :9

Sequence 1:NP_996140.1 Gene:CapaR / 40393 FlyBaseID:FBgn0037100 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_666983.2 Gene:Olfr1189 / 258768 MGIID:3031023 Length:306 Species:Mus musculus


Alignment Length:355 Identity:71/355 - (20%)
Similarity:141/355 - (39%) Gaps:93/355 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 EFVAFVLGPQTLPLYKAVLITIIFGGIFITGVVGNLLVCIVIIRHSAMHTATNYYLFSLAVSDLL 116
            ||:  :||....|..:.:| :::|..:::..|.||||:.:.|.|..::.:...::|.||::.|:.
Mouse     9 EFI--LLGVTRDPELRKIL-SVLFLIMYMATVFGNLLIVVTITRSPSLRSPMYFFLLSLSLMDVT 70

  Fly   117 Y--------LLFGLPTEVFLYWHQYPDLFGMPFCKIRAFISEACTYVSVFTIVAFSMERFLAICH 173
            |        ::..|.....:.:.:         |..:.|.......|.:..::..:.:|::|||.
Mouse    71 YSSVIAPKLIMDSLSERTIVSFER---------CMTQLFAEHFFGGVGIILLIVMAYDRYVAICK 126

  Fly   174 PLHLYAMVGFKRAIRIITALWIVSFISAIPFGLLSDIQYL---NYPLDHSRIEESAFCSMSP--- 232
            |||...|:..:....::...|:...:.|       .||.|   ..|...|.|.:...|.:.|   
Mouse   127 PLHYVKMMTPRVCCLMVGGAWVGGSMHA-------TIQLLFMYQIPFCSSNIIDHFMCDLFPLLK 184

  Fly   233 ------------KIVNEIPVFEVSFCIFFVIPMILIILLYGRMGAKIRSRTNQKLGVQQGTNNRE 285
                        .|:|...:....|.|.....|:::..|                         :
Mouse   185 LACMDTHILGLLVILNSGVMCVSIFLILIASYMVILCSL-------------------------K 224

  Fly   286 TRNSQMRKKTVIRMLA--AVVITFFV-CWFPFHLQRLIFLYAKNMDNYLDINEAL---FSIAGFA 344
            :.:|:.|:|.:....:  .||:.||| |         ||||.:.:..: .|::|:   |:|    
Mouse   225 SYSSEGRRKALSTCSSHFTVVVLFFVPC---------IFLYMRPVVTF-PIDKAMAVSFTI---- 275

  Fly   345 YYVSCTVNPIVYSVMSRRYRVAFRELLCGK 374
              |...:||::|::.:...:.|.:. :|.|
Mouse   276 --VEPMLNPLIYTLRNTEVKYAIKN-MCRK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CapaRNP_996140.1 7tm_4 85..374 CDD:304433 62/320 (19%)
7tm_1 85..356 CDD:278431 59/302 (20%)
Olfr1189NP_666983.2 7tm_4 29..299 CDD:304433 63/327 (19%)
7tm_1 39..285 CDD:278431 59/302 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.