DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CapaR and Olfr114

DIOPT Version :9

Sequence 1:NP_996140.1 Gene:CapaR / 40393 FlyBaseID:FBgn0037100 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_666399.1 Gene:Olfr114 / 258284 MGIID:2177497 Length:312 Species:Mus musculus


Alignment Length:343 Identity:71/343 - (20%)
Similarity:136/343 - (39%) Gaps:96/343 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 VLITIIFGGIFITGVVGNLLVCIVIIRHSAMHTATNYYLFSLAVSDLLYLLFGLPTEVFLYWHQY 133
            :|..::|...::.|..||:::..:......:.:...|:|..|::.||..|...:|        ||
Mouse    25 ILQAVLFLVTYLVGSAGNVIIITITTLDPQLQSPMYYFLKQLSILDLSSLSVTVP--------QY 81

  Fly   134 PD---------LFGMPFCKIRAFISEACTYVSVFTIVAFSMERFLAICHPLHLYAMVGFKRAIR- 188
            .|         .:|....:|..|...|...:::.|::::  :|::|:|.||| |.::...|..| 
Mouse    82 VDSSLARSGYISYGQCMLQIFFFTWFAWGEMAILTVMSY--DRYIAVCLPLH-YEIIMCPRKCRW 143

  Fly   189 IITALWIVSFISAIPFGLLSDIQYLNYPLDHSRIEESAFCSMSPKIV-----NEIPVF------- 241
            .:||:|:   .|:|| |.|......:..:..::|....||.: |:::     |:..|.       
Mouse   144 AVTAVWL---SSSIP-GTLYLATIFSIRICRAKIIHQFFCDV-PQLLKLSCSNDYLVIMGVADFL 203

  Fly   242 -EVSFCIFFVIPMILIILLYGRMGAKIRSRTNQKLGVQQGTNNRETRNSQMRKKTVIRMLAA--- 302
             .:.|..|     :.|::.|..:.:                             ||:||.:|   
Mouse   204 SVIGFACF-----VGIVISYVHIFS-----------------------------TVLRMPSAESR 234

  Fly   303 -----------VVITFFVCWFPFHLQRLIFLYAKNMDNYLDINEALFSIAGFAYYVSCTVNPIVY 356
                       .|::.|       |...||.|.....::....|.|||:  |...:..|:||::|
Mouse   235 SKVFSTCLPHLFVVSLF-------LSTGIFAYLNPTSDFPTALEFLFSV--FYTVLPPTLNPVIY 290

  Fly   357 SVMSRRYRVAFRELLCGK 374
            |:.:...:...|:||..:
Mouse   291 SLRNDAIKSVVRKLLLSR 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CapaRNP_996140.1 7tm_4 85..374 CDD:304433 68/325 (21%)
7tm_1 85..356 CDD:278431 63/307 (21%)
Olfr114NP_666399.1 7tm_4 31..308 CDD:304433 70/335 (21%)
7tm_1 41..290 CDD:278431 63/307 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.