DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CapaR and OR8K5

DIOPT Version :9

Sequence 1:NP_996140.1 Gene:CapaR / 40393 FlyBaseID:FBgn0037100 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001004058.2 Gene:OR8K5 / 219453 HGNCID:15315 Length:307 Species:Homo sapiens


Alignment Length:342 Identity:79/342 - (23%)
Similarity:142/342 - (41%) Gaps:71/342 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 EFVAFVL--GPQ-TLPLYKAVLITIIFGGIFITGVVGNLLVCIVIIRHSAMHTATNYYLFSLAVS 113
            ||:...|  .|: .:||:...|:      |::..|||||.:.|:....|.:||...:.:..||..
Human    11 EFILMELTRRPELQIPLFGVFLV------IYLITVVGNLTMIILTKLDSHLHTPMYFSIRHLAFV 69

  Fly   114 DL---------LYLLFGLPTEVFLYWHQYPDL-FGMPFCKIRAFISEACTYVSVFTIVAFSMERF 168
            ||         :...|.:......|:.....| |.:.|     .|||      .|.:.|.:.:|:
Human    70 DLGNSTVICPKVLANFVVDRNTISYYACAAQLAFFLMF-----IISE------FFILSAMAYDRY 123

  Fly   169 LAICHPLHLYAMVGFKRAIRIITAL-WIVSFISAIPFGLLSDIQYLNYPLDHSRIEESAFCSMSP 232
            :|||:|| ||.::..:|...::..: ::.|...|:.|    .|:........|.:....:|...|
Human   124 VAICNPL-LYYVIMSQRLCHVLVGIQYLYSTFQALMF----TIKIFTLTFCGSNVISHFYCDDVP 183

  Fly   233 KI------VNEIPVFEVSFCIFFVIPMILIILLYGRMGAKIRSRTNQKLGVQQGTNNRETRNSQM 291
            .:      ..||.:..:.|.:|.:|...||:|:         |.....|.:.|      ..:::.
Human   184 LLPMLCSNAQEIELLSILFSVFNLISSFLIVLV---------SYMLILLAICQ------MHSAEG 233

  Fly   292 RKK--TVIRMLAAVVITFFVCWFPFHLQRLIFLYAK-NMDNYLDINEALFSIAGFAYYVSCTVNP 353
            |||  :.......||:.|:        ..|:|:|.: |..::.| .:.:.|:  |...|...:||
Human   234 RKKAFSTCGSHLTVVVVFY--------GSLLFMYMQPNSTHFFD-TDKMASV--FYTLVIPMLNP 287

  Fly   354 IVYSVMSRRYRVAFREL 370
            ::||:.:...:.||.:|
Human   288 LIYSLRNEEVKNAFYKL 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CapaRNP_996140.1 7tm_4 85..374 CDD:304433 69/306 (23%)
7tm_1 85..356 CDD:278431 64/290 (22%)
OR8K5NP_001004058.2 7tm_4 31..305 CDD:304433 73/322 (23%)
7tm_1 41..290 CDD:278431 64/290 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.