DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CapaR and srw-97

DIOPT Version :9

Sequence 1:NP_996140.1 Gene:CapaR / 40393 FlyBaseID:FBgn0037100 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_494034.1 Gene:srw-97 / 191118 WormBaseID:WBGene00005844 Length:372 Species:Caenorhabditis elegans


Alignment Length:484 Identity:96/484 - (19%)
Similarity:172/484 - (35%) Gaps:183/484 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ELNASFTNTPDTLFATSVSSDPSHGFGEEDYACGTFNCSPKEFVAFVLGPQTLPLYKAVLIT--- 72
            |.:..|..|.:.:|       |||.                         ..|.||:.:|:.   
 Worm     2 ENDTEFVTTAEFMF-------PSHA-------------------------NKLELYRILLLLEQF 34

  Fly    73 ----------IIFGGIFITGVVGNLLVCIVIIRHSAMHTATNYYLFSLAVSDLLYLLFGLPTEVF 127
                      :.|.||.:|     :....::.|.:.|.::....:..:|:.|::.:|..:.| |.
 Worm    35 ARPSLWFQFYLSFFGILLT-----IFHLYILTRKAMMISSIIAIMIGIAICDVVAMLAAILT-VN 93

  Fly   128 LYWHQ-----------YPDLFGMPFCKIRAFISEACTYVSVFTIVAFSMERFLAICHPLHLYAMV 181
            :|:.:           :...|...|..||.|:..|.|:::    ||.::.|::.|    ...|.:
 Worm    94 IYFDEEGTDCTPPVSLFNFQFSWAFITIRDFVRRASTWLA----VAMALIRYVII----KFGATM 150

  Fly   182 GFKRAIR----IITALWIVSFISAIPFGLLSDIQYLNY----------PLDH-SRIEES----AF 227
            .|.:..:    .:...|  .|:.:..|.|   :.|..|          |.|| :.::.|    ||
 Worm   151 KFDKCSKPRFGFLVIFW--CFLFSAFFSL---VYYFRYDFVLKKDPWQPKDHCTDVDHSLKLDAF 210

  Fly   228 CSMSP--------------KIVNEIPVFEVSFCIFFVIPMILIILLYGRMGAKIRSRTNQKLGVQ 278
            .....              ::||.| :.::..||  ::|::.|:|:               |.::
 Worm   211 TQKLAYIFTVYGGILGKIYQLVNGI-LSKILPCI--LLPILTILLI---------------LELR 257

  Fly   279 QGTNNRETRNSQMRKKTVIRMLAAVV---ITFFVCWFPFHLQRLIFLYAKNMDNYLDINEALFSI 340
            :...||:..|:..:|.|..:....|:   |:||:...|..: .|:|..|     |.|     |..
 Worm   258 KAEKNRKNSNTNAKKLTSEKTTGLVIFMTISFFLLELPIGI-GLVFQVA-----YTD-----FGY 311

  Fly   341 AGFAYYVS------CTVNPIVYSV----MSRRYRVAFRELLCGKAVGAYYNSGFARDHSSFRESS 395
            ..||.||:      |.:|.:.:..    ||.:||:         .|||            ..:..
 Worm   312 LYFATYVNHLVNSICIINALTHGAVMFSMSSQYRI---------TVGA------------MLKVK 355

  Fly   396 AYDRVHSVHVRASQHPNKFETDSSSANRV 424
            |.|||..|            :.||::|||
 Worm   356 ASDRVFIV------------SHSSTSNRV 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CapaRNP_996140.1 7tm_4 85..374 CDD:304433 68/345 (20%)
7tm_1 85..356 CDD:278431 64/323 (20%)
srw-97NP_494034.1 7TM_GPCR_Srw 41..355 CDD:370978 75/382 (20%)
TM helix 2 69..95 CDD:341315 5/26 (19%)
TM helix 3 115..145 CDD:341315 10/37 (27%)
TM helix 4 159..179 CDD:341315 4/24 (17%)
TM helix 5 212..251 CDD:341315 6/41 (15%)
TM helix 6 273..303 CDD:341315 7/30 (23%)
TM helix 7 316..341 CDD:341315 4/24 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.