DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CapaR and srw-115

DIOPT Version :9

Sequence 1:NP_996140.1 Gene:CapaR / 40393 FlyBaseID:FBgn0037100 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_503815.2 Gene:srw-115 / 187325 WormBaseID:WBGene00005862 Length:367 Species:Caenorhabditis elegans


Alignment Length:352 Identity:77/352 - (21%)
Similarity:135/352 - (38%) Gaps:95/352 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 IFITGVVGNLLVCIVIIRHSAMHTATNYYLFSLAVSDLLYLL----FGLPTEVFLYWHQYPD-LF 137
            :.|..::.||:...::.|.....::.|..:.::|:.|:|..|    ..|....::::..||. .:
 Worm    45 VSIASILINLIHFFILTRKPMRTSSINILMAAIALFDILASLQQIELLLDRYSYIFFDCYPTYTY 109

  Fly   138 GMPFCK-----IRAFISEACTYVSVFTIVAF---------SMERFLAICHPLHLYAMVGFKRAIR 188
            |:...|     :|.:.....|::.||  :||         ...:|.|:|.|         |.:..
 Worm   110 GLELTKVLLDVVRDYSRRCSTWLIVF--IAFIRTLIVRNPMSTKFEALCQP---------KASAI 163

  Fly   189 IITALWIVSFISAIPFGLLSDIQYLNYPLDHSRIEESAFCSMSPKIVNEIPVFEVS--------- 244
            ||..:...||    |..:|..::|     ....||....|:..|.     .:|.||         
 Worm   164 IIAGICATSF----PVSVLKFLEY-----QFIEIEGLESCAKGPH-----HIFAVSDLFTANDGF 214

  Fly   245 ----FCIF--FV---IPMILI----ILLYGRMGAKIRSRTNQKLGVQQGTNNRETRNSQMRKKTV 296
                |.:|  ||   :|.||:    :||...:....:.||| .:.|.:..|:|            
 Worm   215 LAKYFYLFNSFVSDIVPCILLPIVTLLLVMDLWRAAKKRTN-LISVSKNHNSR------------ 266

  Fly   297 IRMLAAVVITFFVCWFPFHLQR-LIFLYAKNMDNYLDINEALFSIAGFAYYVSCTVNP----IVY 356
            ..::..|.|.||:..||:.|.. .:::|    ::.|.:...:...| |.:.:..|:|.    .|.
 Worm   267 TGLVFCVTIMFFIVEFPYGLSMGFVWMY----NDVLGLQHMMSRFA-FMFAMLITLNTCTHLFVC 326

  Fly   357 SVMSRRYR-VAFRELLCGKAVGAYYNS 382
            .::|..|| .|.....||     |.||
 Worm   327 LIISSHYRSTAIYVFSCG-----YINS 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CapaRNP_996140.1 7tm_4 85..374 CDD:304433 72/335 (21%)
7tm_1 85..356 CDD:278431 66/316 (21%)
srw-115NP_503815.2 TM helix 1 41..62 CDD:320109 3/16 (19%)
7TM_GPCR_Srw 45..344 CDD:370978 72/341 (21%)
TM helix 2 71..93 CDD:320109 5/21 (24%)
TM helix 3 116..138 CDD:320109 4/23 (17%)
TM helix 4 163..179 CDD:320109 5/19 (26%)
TM helix 5 217..240 CDD:320109 7/22 (32%)
TM helix 6 267..289 CDD:320109 7/21 (33%)
TM helix 7 305..330 CDD:320109 5/25 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.