DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CapaR and srw-72

DIOPT Version :9

Sequence 1:NP_996140.1 Gene:CapaR / 40393 FlyBaseID:FBgn0037100 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001309457.1 Gene:srw-72 / 184734 WormBaseID:WBGene00005819 Length:347 Species:Caenorhabditis elegans


Alignment Length:350 Identity:71/350 - (20%)
Similarity:127/350 - (36%) Gaps:107/350 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 ITIIFGGIFITGVVGNLLVCIVIIRHSAMHTATNYYLFSLAVSDLLYLLFGLPTEVFLYW----- 130
            :..|||.||      .|....::.|.|...:.||..:..:|:.|::.||..:....:.:|     
 Worm    22 VVSIFGFIF------TLPHLFILTRKSMRTSCTNSIMMGIAIVDIIVLLEIILNRAYGFWILENP 80

  Fly   131 ----HQYP-DLFGM------------PFC-------------KIRAFISEACTYVSVFTIVAFSM 165
                ..|. :||.:            .||             |:|.......:  |||..:.|.:
 Worm    81 CLNYESYNFELFLLIGEFLGDTGERTSFCLGVFLVLIRLIITKLRGSADSLSS--SVFGYIVFIL 143

  Fly   166 ERFLAICHPLHLYAMVGFKRAIRIITALWIVSFISAIPFGLLSDIQYLNYPLDHSRIEESAFCSM 230
               |.|.|.|..|             :.:...|:...||....:.:.:..|.::|   |..:...
 Worm   144 ---LLILHSLISY-------------SFYSTFFLREWPFSWKPNEKCIELPQNYS---EKVYIRA 189

  Fly   231 SPKIVNEIPVFEVSFCIFFV-----------IPMI-LIILLYGRMGAKIRSRTNQKLGVQQGTNN 283
            | |:  :|.:|:.:.|..|:           .|:: |:::|..|..||..|..::|       ..
 Worm   190 S-KV--DIILFDPAECYNFITGLSKIVVSVMYPVLALMLILDIRKSAKTASSLSEK-------RA 244

  Fly   284 RETRNSQMRKKTVIRMLAAVVITFFVCWFPFHLQRLIFLYAK-NMDNYLDI--------NEALFS 339
            :|..:|.       ||:..:.|.:.:...|..:...|.:|.: ..|:.|.:        .:|||.
 Worm   245 KERYHSG-------RMILVMTIFYTIASAPGGIANFIEVYIEIPTDSLLMVILGQGSIFFQALFC 302

  Fly   340 IAGFAYYVSCTVNPIVYSVMSRRYR 364
            ....::   |.:|   :| ||..||
 Worm   303 FNSASH---CLIN---FS-MSTNYR 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CapaRNP_996140.1 7tm_4 85..374 CDD:304433 65/335 (19%)
7tm_1 85..356 CDD:278431 61/326 (19%)
srw-72NP_001309457.1 7TM_GPCR_Srw 18..329 CDD:287314 70/349 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.