DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CapaR and OR6B1

DIOPT Version :9

Sequence 1:NP_996140.1 Gene:CapaR / 40393 FlyBaseID:FBgn0037100 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001005281.1 Gene:OR6B1 / 135946 HGNCID:8354 Length:311 Species:Homo sapiens


Alignment Length:329 Identity:71/329 - (21%)
Similarity:138/329 - (41%) Gaps:62/329 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 PQTLPLYKAVLITIIFGGIFITGVVGNLLVCIVIIRHSAMHTATNYYLFSLAVSDLLYLLFGLPT 124
            |.:|.:..|:.  :||...:|..|..|:::.::::::..:|....::|.:|:..:..|:...:|.
Human    18 PGSLSMRAAMF--LIFLVAYILTVAENVIIILLVLQNRPLHKPMYFFLANLSFLETWYISVTVPK 80

  Fly   125 EVFLYWHQYPDLFGMPFCKIRA--FISEACTYVSVFTIVAFSMERFLAICHPLHLYAMVGFKRAI 187
            .:|.:| ...:......|.|:.  ||:..||  ....:.|.:.:|::|||.|||...::......
Human    81 LLFSFW-SVNNSISFTLCMIQLYFFIALMCT--ECVLLAAMAYDRYVAICRPLHYPTIMSHGLCF 142

  Fly   188 RIITALWIVSF-ISAIPFGLLSDIQYLNYPLDHSRIEESAFCSMSPKI--------VNEIPVFEV 243
            |:....|.:.| ||......:|.:.:..     ..:....||.:||.:        :.|:..|.:
Human   143 RLALGSWAIGFGISLAKIYFISCLSFCG-----PNVINHFFCDISPVLNLSCTDMSITELVDFIL 202

  Fly   244 SFCIFFVIPMILIILLYGRMGAKIRSRTNQKLGVQQGTNNRETRNSQMRKKTVIRMLAAVVITFF 308
            :. :.|:.|:.:.:|.||.:.|.|......|               |....|....|  ||:|.|
Human   203 AL-VIFLFPLFITVLSYGCILATILCMPTGK---------------QKAFSTCASHL--VVVTIF 249

  Fly   309 VCWFPFHLQRLIFLYAK-------NMDNYLDINEALFSIAGFAYYVSCTVNPIVYSVMSRRYRVA 366
                   ...:||:||:       ||:..:.|         |...|:.::||.:|.:.:|..:.|
Human   250 -------YSAIIFMYARPRVIHAFNMNKIISI---------FYAIVTPSLNPFIYCLRNREVKEA 298

  Fly   367 FREL 370
            .::|
Human   299 LKKL 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CapaRNP_996140.1 7tm_4 85..374 CDD:304433 64/304 (21%)
7tm_1 85..356 CDD:278431 60/288 (21%)
OR6B1NP_001005281.1 7tmA_OR6B-like 26..292 CDD:320352 66/309 (21%)
TM helix 1 26..52 CDD:320352 6/27 (22%)
TM helix 2 59..85 CDD:320352 5/25 (20%)
TM helix 3 97..127 CDD:320352 9/31 (29%)
TM helix 4 141..159 CDD:320352 5/17 (29%)
TM helix 5 195..225 CDD:320352 8/30 (27%)
TM helix 6 231..260 CDD:320352 12/52 (23%)
TM helix 7 267..292 CDD:320352 8/33 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.