Sequence 1: | NP_996140.1 | Gene: | CapaR / 40393 | FlyBaseID: | FBgn0037100 | Length: | 477 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001121876.1 | Gene: | or64a1 / 100150287 | ZFINID: | ZDB-GENE-070806-105 | Length: | 314 | Species: | Danio rerio |
Alignment Length: | 316 | Identity: | 60/316 - (18%) |
---|---|---|---|
Similarity: | 112/316 - (35%) | Gaps: | 128/316 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 KEFV--AFVLGPQTLPLYKAVLITIIFGGIFITGVVGNLLVCIVIIRHSAMHTATNYYLFSLAVS 113
Fly 114 DLLYLLFGLPTEVFLYWHQYPDLFGMPFCKIRAFISEACTYVSVFTIVAFSM-----------ER 167
Fly 168 FLAICHPLHLYAMVGFKRAIR--------IITALWIVSFISA-IPF------------------- 204
Fly 205 ---GLLSD-------------------------------------------------IQYLNYPL 217
Fly 218 DHSRIEESAFC--SMSPKIVNEIPVFEVSFCI-FFVIPMILIILLYGRMGAKIRSR 270 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CapaR | NP_996140.1 | 7tm_4 | 85..374 | CDD:304433 | 50/280 (18%) |
7tm_1 | 85..356 | CDD:278431 | 50/280 (18%) | ||
or64a1 | NP_001121876.1 | 7tm_4 | 32..304 | CDD:304433 | 53/300 (18%) |
7tm_1 | 40..289 | CDD:278431 | 46/267 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |