DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CapaR and or64a1

DIOPT Version :9

Sequence 1:NP_996140.1 Gene:CapaR / 40393 FlyBaseID:FBgn0037100 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001121876.1 Gene:or64a1 / 100150287 ZFINID:ZDB-GENE-070806-105 Length:314 Species:Danio rerio


Alignment Length:316 Identity:60/316 - (18%)
Similarity:112/316 - (35%) Gaps:128/316 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KEFV--AFVLGPQTLPLYKAVLITIIFGGIFITGVVGNLLVCIVIIRHSAMHTATNYYLFSLAVS 113
            ||||  .:|:...||.:|.|:             :|.|.::..|:.:..::|......:..|:|:
Zfish    16 KEFVHIRYVILTLTLTVYLAI-------------IVCNAIILFVVFKERSLHEPMYILISCLSVN 67

  Fly   114 DLLYLLFGLPTEVFLYWHQYPDLFGMPFCKIRAFISEACTYVSVFTIVAFSM-----------ER 167
            | ||...|.          :|.|.........|....|| :|.:|||.:::|           :|
Zfish    68 D-LYGSAGF----------FPRLIADLLSDTNAISRPAC-FVQIFTIYSYAMSEYTILTLMAYDR 120

  Fly   168 FLAICHPLHLYAMVGFKRAIR--------IITALWIVSFISA-IPF------------------- 204
            ::|||:||..:.::..:...|        ::.::.:|.|.|| :|.                   
Zfish   121 YVAICNPLKYHKIMSLRLTARYMAMASFCVVFSMALVIFFSAKLPLCGTDVTRLYCSNWSVVRLS 185

  Fly   205 ---GLLSD-------------------------------------------------IQYLNYPL 217
               ..||:                                                 :.::||.:
Zfish   186 CGTSTLSNNILGFFVTTATVFLPAFFILYTYIRILIICQKSSKEFKGKALQTCLPHIVSFVNYSI 250

  Fly   218 DHSRIEESAFC--SMSPKIVNEIPVFEVSFCI-FFVIPMILIILLYGRMGAKIRSR 270
                   ::||  ::|....::|.:..:.|.: |.|||.:|..|:||....:||.:
Zfish   251 -------ASFCDIALSRNDSDKIKILTIIFSVEFLVIPPVLNPLIYGLNLPEIRKK 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CapaRNP_996140.1 7tm_4 85..374 CDD:304433 50/280 (18%)
7tm_1 85..356 CDD:278431 50/280 (18%)
or64a1NP_001121876.1 7tm_4 32..304 CDD:304433 53/300 (18%)
7tm_1 40..289 CDD:278431 46/267 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.