powered by:
Protein Alignment COX8 and Cox8c
DIOPT Version :9
Sequence 1: | NP_001262169.1 |
Gene: | COX8 / 40390 |
FlyBaseID: | FBgn0263911 |
Length: | 68 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_898878.1 |
Gene: | Cox8c / 360229 |
RGDID: | 727840 |
Length: | 72 |
Species: | Rattus norvegicus |
Alignment Length: | 42 |
Identity: | 12/42 - (28%) |
Similarity: | 26/42 - (61%) |
Gaps: | 1/42 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 SGPPTQRISTAEKVILGGGMCAASLFIP-AWVLYHIRDYKGD 67
|..|..::.|..:.::|..:..|:.||| |:|:.:::.:||:
Rat 31 SESPQNQVLTPTESVVGIVVFFATFFIPAAYVMSNLKFFKGE 72
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR16717 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
2 | 2.060 |
|
Return to query results.
Submit another query.