DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX8 and Cox8b

DIOPT Version :9

Sequence 1:NP_001262169.1 Gene:COX8 / 40390 FlyBaseID:FBgn0263911 Length:68 Species:Drosophila melanogaster
Sequence 2:NP_036918.2 Gene:Cox8b / 25250 RGDID:2386 Length:70 Species:Rattus norvegicus


Alignment Length:41 Identity:13/41 - (31%)
Similarity:21/41 - (51%) Gaps:1/41 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VSGPPTQRISTAEKVILGGGMCAASLFIPA-WVLYHIRDYK 65
            :|..|.:..::|....:|..:..|...:|| |||.|:..||
  Rat    25 ISSKPAKSPTSAMDQAVGMSVIIAGFMVPAGWVLSHLESYK 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX8NP_001262169.1 COX8 26..65 CDD:280450 11/39 (28%)
Cox8bNP_036918.2 COX8 26..66 CDD:396733 13/40 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1632471at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR16717
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
33.070

Return to query results.
Submit another query.