powered by:
Protein Alignment COX8 and Cox8a
DIOPT Version :9
Sequence 1: | NP_001262169.1 |
Gene: | COX8 / 40390 |
FlyBaseID: | FBgn0263911 |
Length: | 68 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_031776.1 |
Gene: | Cox8a / 12868 |
MGIID: | 105959 |
Length: | 69 |
Species: | Mus musculus |
Alignment Length: | 62 |
Identity: | 21/62 - (33%) |
Similarity: | 30/62 - (48%) |
Gaps: | 11/62 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 SAARLLVPAMRSAMQSRCQSVVSGPPTQRISTAEKVILGGGMCAASLFIPA-WVLYHIRDYK 65
||.||:|| |.| |.|.|..:::...: :.:|...|.....:|| |||.|:..||
Mouse 15 SARRLMVP--------RAQ-VHSKPAREQLGVLD-ITIGLTSCFVCCLLPAGWVLSHLESYK 66
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
COX8 | NP_001262169.1 |
COX8 |
26..65 |
CDD:280450 |
10/39 (26%) |
Cox8a | NP_031776.1 |
COX8 |
27..67 |
CDD:396733 |
12/41 (29%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1632471at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR16717 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
3 | 3.070 |
|
Return to query results.
Submit another query.