powered by:
Protein Alignment COX8 and si:dkey-85n7.8
DIOPT Version :9
Sequence 1: | NP_001262169.1 |
Gene: | COX8 / 40390 |
FlyBaseID: | FBgn0263911 |
Length: | 68 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001373245.1 |
Gene: | si:dkey-85n7.8 / 100330915 |
ZFINID: | ZDB-GENE-110411-127 |
Length: | 76 |
Species: | Danio rerio |
Alignment Length: | 58 |
Identity: | 17/58 - (29%) |
Similarity: | 31/58 - (53%) |
Gaps: | 2/58 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 LLVPAMRSAMQSRCQSVVSGPPTQRISTAEKVILGGGMCAASLFIPA-WVLYHIRDYK 65
::|...|..:..|..|:.|.||..:|...:..:: ..:.|.:|..|| |:|:||.:|:
Zfish 12 VMVSRTRDIVHKRNSSIYSKPPKNKIGPGQSFLI-MSVFAVALLAPAGWILHHIPEYR 68
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
COX8 | NP_001262169.1 |
COX8 |
26..65 |
CDD:280450 |
12/39 (31%) |
si:dkey-85n7.8 | NP_001373245.1 |
COX8 |
29..69 |
CDD:396733 |
13/41 (32%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1632471at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR16717 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.020 |
|
Return to query results.
Submit another query.