powered by:
Protein Alignment VhaM9.7-b and Atp6v0e2
DIOPT Version :9
Sequence 1: | NP_001262170.1 |
Gene: | VhaM9.7-b / 40389 |
FlyBaseID: | FBgn0028663 |
Length: | 89 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001334093.1 |
Gene: | Atp6v0e2 / 76252 |
MGIID: | 1923502 |
Length: | 112 |
Species: | Mus musculus |
Alignment Length: | 44 |
Identity: | 21/44 - (47%) |
Similarity: | 27/44 - (61%) |
Gaps: | 3/44 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 IVITSIWAFIGIICPFFA-RGPNRGVTQCCLMLTAATCWLFWLC 51
|:.|:.|..|||..|:|. :||||||....|:.||..|:| ||
Mouse 11 IIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATAVCCYL--LC 52
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
VhaM9.7-b | NP_001262170.1 |
ATP_synt_H |
9..64 |
CDD:398897 |
21/44 (48%) |
Atp6v0e2 | NP_001334093.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167842282 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3500 |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
82 |
1.000 |
Inparanoid score |
I5178 |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S2878 |
OMA |
1 |
1.010 |
- |
- |
|
QHG49180 |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001872 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
mtm8760 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR12263 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2893 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X1797 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
13 | 12.840 |
|
Return to query results.
Submit another query.