DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaM9.7-b and Atp6v0e2

DIOPT Version :9

Sequence 1:NP_001262170.1 Gene:VhaM9.7-b / 40389 FlyBaseID:FBgn0028663 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001002253.1 Gene:Atp6v0e2 / 436582 RGDID:1303238 Length:81 Species:Rattus norvegicus


Alignment Length:70 Identity:32/70 - (45%)
Similarity:41/70 - (58%) Gaps:1/70 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IVITSIWAFIGIICPFFA-RGPNRGVTQCCLMLTAATCWLFWLCCYMTQLNPLIGPKLSMNEIMI 72
            |:.|:.|..|||..|:|. :||||||....|:.||..|:||||...:.|||||.||:|....|..
  Rat    11 IIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQLNPLFGPQLKNETIWY 75

  Fly    73 MAREW 77
            :...|
  Rat    76 VRFLW 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaM9.7-bNP_001262170.1 ATP_synt_H 9..64 CDD:398897 28/55 (51%)
Atp6v0e2NP_001002253.1 ATP_synt_H 9..67 CDD:398897 28/55 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345712
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3500
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5099
OMA 1 1.010 - - QHG49180
OrthoDB 1 1.010 - - D1613627at2759
OrthoFinder 1 1.000 - - FOG0001872
OrthoInspector 1 1.000 - - mtm9005
orthoMCL 1 0.900 - - OOG6_102348
Panther 1 1.100 - - O PTHR12263
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1797
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.770

Return to query results.
Submit another query.