DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaM9.7-b and vha-17

DIOPT Version :9

Sequence 1:NP_001262170.1 Gene:VhaM9.7-b / 40389 FlyBaseID:FBgn0028663 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_501636.2 Gene:vha-17 / 177757 WormBaseID:WBGene00009882 Length:86 Species:Caenorhabditis elegans


Alignment Length:74 Identity:30/74 - (40%)
Similarity:52/74 - (70%) Gaps:2/74 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PIV-ITSIWAFIGIICPFFA-RGPNRGVTQCCLMLTAATCWLFWLCCYMTQLNPLIGPKLSMNEI 70
            |:| :::.||.||...|:.. :|||||:.|..:::||..||:||:..::.||||||||::::..|
 Worm     6 PLVSVSAFWAIIGFGGPWIVPKGPNRGIIQLMIIMTAVCCWMFWIMVFLHQLNPLIGPQINVKTI 70

  Fly    71 MIMAREWGN 79
            ..::.:||:
 Worm    71 RWISEKWGD 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaM9.7-bNP_001262170.1 ATP_synt_H 9..64 CDD:398897 25/56 (45%)
vha-17NP_501636.2 ATP_synt_H 6..64 CDD:283211 26/57 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159620
Domainoid 1 1.000 69 1.000 Domainoid score I6287
eggNOG 1 0.900 - - E1_KOG3500
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I3806
Isobase 1 0.950 - 0 Normalized mean entropy S2878
OMA 1 1.010 - - QHG49180
OrthoDB 1 1.010 - - D1613627at2759
OrthoFinder 1 1.000 - - FOG0001872
OrthoInspector 1 1.000 - - otm14171
orthoMCL 1 0.900 - - OOG6_102348
Panther 1 1.100 - - O PTHR12263
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2893
SonicParanoid 1 1.000 - - X1797
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.