Sequence 1: | NP_001262170.1 | Gene: | VhaM9.7-b / 40389 | FlyBaseID: | FBgn0028663 | Length: | 89 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001276919.2 | Gene: | ATP6V0E2 / 155066 | HGNCID: | 21723 | Length: | 187 | Species: | Homo sapiens |
Alignment Length: | 62 | Identity: | 31/62 - (50%) |
---|---|---|---|
Similarity: | 40/62 - (64%) | Gaps: | 2/62 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 IVITSIWAFIGIICPFFA-RGPNRGVTQCCLMLTAATCWLFWLCCYMTQLNPLIGPKLSMNE 69 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
VhaM9.7-b | NP_001262170.1 | ATP_synt_H | 9..64 | CDD:398897 | 27/55 (49%) |
ATP6V0E2 | NP_001276919.2 | ATP_synt_H | 9..67 | CDD:398897 | 27/55 (49%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165152219 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3500 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 82 | 1.000 | Inparanoid score | I5197 |
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S2878 |
OMA | 1 | 1.010 | - | - | QHG49180 | |
OrthoDB | 1 | 1.010 | - | - | D1613627at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0001872 | |
OrthoInspector | 1 | 1.000 | - | - | mtm8530 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_102348 | |
Panther | 1 | 1.100 | - | - | O | PTHR12263 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2893 |
SonicParanoid | 1 | 1.000 | - | - | X1797 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
14 | 13.790 |