powered by:
Protein Alignment VhaM9.7-b and atp6v0e2
DIOPT Version :9
Sequence 1: | NP_001262170.1 |
Gene: | VhaM9.7-b / 40389 |
FlyBaseID: | FBgn0028663 |
Length: | 89 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001165046.1 |
Gene: | atp6v0e2 / 100124803 |
XenbaseID: | XB-GENE-5771814 |
Length: | 81 |
Species: | Xenopus tropicalis |
Alignment Length: | 73 |
Identity: | 32/73 - (43%) |
Similarity: | 43/73 - (58%) |
Gaps: | 1/73 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 VAPIVITSIWAFIGIICPFFA-RGPNRGVTQCCLMLTAATCWLFWLCCYMTQLNPLIGPKLSMNE 69
|..|:.|:.|..|||..|:|. :||||||....|:.||..|::|||...:.|||||.||:|..:.
Frog 8 VPMIIFTTFWGLIGIAAPWFVPKGPNRGVIITMLVTTAVCCYIFWLVAILAQLNPLFGPQLKNDT 72
Fly 70 IMIMAREW 77
|..:...|
Frog 73 IWYVRFLW 80
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1613627at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.