DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn10 and PIP5K1A

DIOPT Version :10

Sequence 1:NP_524204.1 Gene:Rpn10 / 40388 FlyBaseID:FBgn0015283 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_006711626.1 Gene:PIP5K1A / 8394 HGNCID:8994 Length:574 Species:Homo sapiens


Alignment Length:39 Identity:11/39 - (28%)
Similarity:17/39 - (43%) Gaps:3/39 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ESTMICFDNSDFQRNGDYFPTRLIVQRDGINLVCLTKLR 42
            |..:..|.:.||.::   .|..|.:..|..|.:|.|..|
Human   287 EKPLPTFKDLDFLQD---IPDGLFLDADMYNALCKTLQR 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn10NP_524204.1 VWA_26S_proteasome_subunit 1..187 CDD:238729 11/39 (28%)
PSMD4_RAZUL 341..380 CDD:412092
PIP5K1AXP_006711626.1 PIPKc_PIP5K1A_like 92..467 CDD:340443 11/39 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.