DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn10 and pip5k1ca

DIOPT Version :9

Sequence 1:NP_001262168.1 Gene:Rpn10 / 40388 FlyBaseID:FBgn0015283 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_009294612.1 Gene:pip5k1ca / 798876 ZFINID:ZDB-GENE-050208-358 Length:701 Species:Danio rerio


Alignment Length:391 Identity:75/391 - (19%)
Similarity:121/391 - (30%) Gaps:120/391 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GLMTLSNTVEVLA-TLTSDAGRIFSKMHLVQPKGEINLLTGIRIAHLVLKHRQGKNHKMRIVVFV 113
            |||..::|...|. ||..|. .:.....::    :.:||.|:.......|.:|          ..
Zfish   292 GLMLDTDTYNALVKTLQRDC-LVLESFKIM----DYSLLLGVHNIDQAAKEQQ----------ME 341

  Fly   114 GSPINHEEGDLVKQAKRLKKEKVNVDIVSFGDHGNNNEILTAFINALNGK--------------- 163
            ||..|.:|...:.|.........::...|....|.:.:.....|.|:||:               
Zfish   342 GSQGNSDEKRPLAQKALYTTAMESIQGASACGEGIDTDDTMGGIPAVNGRGERLLLYIGIIDILQ 406

  Fly   164 -----------------DGTGSHLVSVPRGSVLSD---------------ALLSSPIIQGEDGMG 196
                             ||   ..|||.|.|..:|               :|.|||..:|..|:.
Zfish   407 SYRLIKKLEHTWKALVHDG---DTVSVHRPSFYADRFLRFMSSTVFRKTSSLKSSPSKRGRGGLA 468

  Fly   197 -------GAGLGGNVFEFGVDPNEDPELALALRVSMEEQRQRQESEQRRANPDGAP--PTGGDAG 252
                   ||....:...|..|.|     ...||                    ||.  ||..|.|
Zfish   469 VGKYCGPGAAWSASQLPFMRDEN-----IYDLR--------------------GARSFPTLEDDG 508

  Fly   253 GGGGVSGSGPGNEESAGAENEANTEEAMLQRALALSTETPEDNL--PDF---------ANMTEEE 306
            ....:..:.|..||:..|.........   .:|::...:|.|..  |.:         ..|.:|:
Zfish   509 RADVLPCTPPSFEEATTASIATTLSST---TSLSIPERSPSDTSEHPRYRRHTQSSHEETMQDED 570

  Fly   307 QIAFAMQMSMQDAPDDSVTQQAKRPKTDEANAPMDVDEDYSEVIGDPAFLQSVLENLPGVDPQSE 371
            |....:::.::...|...|..|.:...:.:.|...:.|..|..:  ||..:.|:|:    |..|:
Zfish   571 QQTITVEVEVEGRYDSEPTLVAPQVSPEISEAAETIPEASSSSV--PASPRIVVES----DGGSQ 629

  Fly   372 A 372
            |
Zfish   630 A 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn10NP_001262168.1 VWA_26S_proteasome_subunit 1..187 CDD:238729 34/184 (18%)
pip5k1caXP_009294612.1 PIPKc 108..448 CDD:214623 32/173 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.