DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn10 and pip5k1ba

DIOPT Version :9

Sequence 1:NP_001262168.1 Gene:Rpn10 / 40388 FlyBaseID:FBgn0015283 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_005155628.1 Gene:pip5k1ba / 449831 ZFINID:ZDB-GENE-041010-81 Length:529 Species:Danio rerio


Alignment Length:225 Identity:43/225 - (19%)
Similarity:82/225 - (36%) Gaps:61/225 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 KHRQGKNHKMRIVVFVGSPINHEEGDLVKQAKRLKK-EKVNVDIVSFGDHGNNNEILTAFINALN 161
            ||:..|     :::|:|..      |:::..:.:|| |.....:|..||                
Zfish   336 KHKDEK-----LLIFLGII------DILQSYRFIKKVEHSWKALVHDGD---------------- 373

  Fly   162 GKDGTGSHLVSVPRGSVLSDALL---SSPIIQGEDGMGGAGLGGNVFEFGVDPNEDPELALALRV 223
                    .|||.|.:..:|..|   .|.:.:....:.||..........|..:...|:...::.
Zfish   374 --------TVSVHRPNFYADRFLKFMGSTVFKKIHPLRGASSRRKKSSIHVCRSASQEVLSTVKE 430

  Fly   224 SMEEQRQRQ------ESEQRRA--NPDGAPPTGG--DAGGGGGVSGSGPGNEESAGAENEANTEE 278
            ..:::|:.|      :||:..:  .||..|.:.|  .|.....:|.:...::..|.|:.::.:.:
Zfish   431 ESQDERRAQSLENLDDSEETHSCQKPDVIPSSAGLNPAVSAATLSSASSLDDVKAEAQTDSESRD 495

  Fly   279 ---------AMLQRALA---LSTETPEDNL 296
                     |:...|||   .:..|||..|
Zfish   496 DCRASSSTLALEDSALASLNSAPSTPESGL 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn10NP_001262168.1 VWA_26S_proteasome_subunit 1..187 CDD:238729 18/92 (20%)
pip5k1baXP_005155628.1 PIPKc 61..395 CDD:214623 19/93 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.