DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn10 and pof10

DIOPT Version :9

Sequence 1:NP_001262168.1 Gene:Rpn10 / 40388 FlyBaseID:FBgn0015283 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_596201.1 Gene:pof10 / 2539767 PomBaseID:SPBC1703.06 Length:662 Species:Schizosaccharomyces pombe


Alignment Length:241 Identity:53/241 - (21%)
Similarity:93/241 - (38%) Gaps:90/241 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RLIVQRDGINLVCLTKLRSNPENNVGLMTLSNTVEVLA-TLTSDAGRIFSKMHLVQP-------- 80
            |...:|:.||.:.|.   |||.:..|::|:|..|:..: |:........||:..::|        
pombe   473 RNAARREPINCILLD---SNPLSLKGVITMSKHVKSWSYTIPKPFVNKRSKVLPLRPSVTHDNLS 534

  Fly    81 ------KGEI--NLLTGI-RIAHLVLKHRQGKNHKM--------------------RIVVFVGSP 116
                  |.|:  .::.|: :||       |.:..||                    .|:.:| :.
pombe   535 KSSDYSKNEVEREIMLGLDQIA-------QERREKMEARQKFEQHFGEGLVGLSEEEIIAYV-TM 591

  Fly   117 INHEEGDLVKQAKRLKKEKVNVDIVSFGDHGNNNEILTAFINALNGKDGTGSHLVSVPRGSVLSD 181
            ::.||     :|||:.:..::||.:. .|...|:|..|:.:|||     :.:|            
pombe   592 LSQEE-----EAKRMVQLSMDVDKIE-EDFKENDEQATSSLNAL-----SSNH------------ 633

  Fly   182 ALLSSPIIQGEDGMGGAGLGGNVFEFGVDPNEDPELALALRVSMEE 227
               ..|..|           .||.|.    ||..::.||:|:|:.|
pombe   634 ---EPPQEQ-----------ANVAEL----NEQEQIELAMRLSLME 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn10NP_001262168.1 VWA_26S_proteasome_subunit 1..187 CDD:238729 41/199 (21%)
pof10NP_596201.1 F-box-like 31..77 CDD:289689
WD40 124..507 CDD:225201 12/36 (33%)
WD40 repeat 127..166 CDD:293791
WD40 repeat 171..210 CDD:293791
WD40 <208..>282 CDD:295369
WD40 repeat 221..262 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10223
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.