DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn10 and Pip5k1c

DIOPT Version :9

Sequence 1:NP_001262168.1 Gene:Rpn10 / 40388 FlyBaseID:FBgn0015283 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001280575.1 Gene:Pip5k1c / 18717 MGIID:1298224 Length:687 Species:Mus musculus


Alignment Length:215 Identity:46/215 - (21%)
Similarity:71/215 - (33%) Gaps:56/215 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 SDALLSSPIIQGEDGMGGAGLGGNVFEFGVD--PNEDPELALALRVSMEEQRQRQESEQRRANPD 242
            |.:|.|||..:|...:......|....|...  |:|..::...||.:........|     ..||
Mouse   447 SSSLKSSPSKKGRGALLAVKPLGPTAAFSASQIPSEREDVQYDLRGARSYPTLEDE-----GRPD 506

  Fly   243 GAPPTGGDAGGGGGVSGSGPGNEESAGAENEANTEEAMLQRALALSTETPEDNLPDFANMTEEEQ 307
            ..|.|              |.:.|.|...:.|.|   :...:|::...:|.|.       :|:.:
Mouse   507 LLPCT--------------PPSFEEATTASIATT---LSSTSLSIPERSPSDT-------SEQPR 547

  Fly   308 IAFAMQMSMQD--------APD-DSVTQQAKR-------PKTD---------EANAPMDVDEDYS 347
            .....|.|.||        |.| ..:|.|.:.       ||.:         .|:|...|:.|.:
Mouse   548 YRRRTQSSGQDGRPQEEPHAEDLQKITVQVEPVCGVGVVPKEEGAGVEVPPCGASAAASVEIDAA 612

  Fly   348 EVIGDPAFLQSVLENLPGVD 367
            ....:||...|..|:.|..|
Mouse   613 SQASEPASQASDEEDAPSTD 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn10NP_001262168.1 VWA_26S_proteasome_subunit 1..187 CDD:238729 3/6 (50%)
Pip5k1cNP_001280575.1 PIPKc 103..443 CDD:214623
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.