DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7611 and PRP46

DIOPT Version :9

Sequence 1:NP_001163489.1 Gene:CG7611 / 40386 FlyBaseID:FBgn0037094 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_015174.1 Gene:PRP46 / 855952 SGDID:S000006072 Length:451 Species:Saccharomyces cerevisiae


Alignment Length:163 Identity:40/163 - (24%)
Similarity:70/163 - (42%) Gaps:44/163 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   464 DNHYRIRGYNFDSPRSDFDI--------------------LREPHPIMTFSINSADRLALLNVSN 508
            ||.:.|.|.| |:....:|:                    :.:.||.: ||::          .:
Yeast   151 DNEWFITGSN-DTTMKVWDLATGKLKTTLAGHVMTVRDVAVSDRHPYL-FSVS----------ED 203

  Fly   509 QGLHLWDIEDKCLVRRF----QGIRQSNFAIHSCFGGVNESFVASGSEDKVVYIWHIKREEPLAK 569
            :.:..||:|...::|.:    .|:|  ..:||...     ..:|:...|.|:.:|.::...|:..
Yeast   204 KTVKCWDLEKNQIIRDYYGHLSGVR--TVSIHPTL-----DLIATAGRDSVIKLWDMRTRIPVIT 261

  Fly   570 LAGHTKTVNCVSWNPVYPSLLASASDDATVRIW 602
            |.||...:|.|...||.|.:: |:|.|||||:|
Yeast   262 LVGHKGPINQVQCTPVDPQVV-SSSTDATVRLW 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7611NP_001163489.1 CTLH 129..190 CDD:128914
WD40 <303..605 CDD:225201 40/163 (25%)
WD40 307..602 CDD:295369 39/161 (24%)
WD40 repeat 318..358 CDD:293791
WD40 repeat 364..402 CDD:293791
WD40 repeat 410..444 CDD:293791
WD40 repeat 448..534 CDD:293791 17/93 (18%)
WD40 repeat 577..602 CDD:293791 12/24 (50%)
PRP46NP_015174.1 WD40 131..427 CDD:238121 40/163 (25%)
WD40 repeat 144..180 CDD:293791 7/29 (24%)
WD40 repeat 186..222 CDD:293791 8/46 (17%)
WD40 repeat 227..263 CDD:293791 8/42 (19%)
WD40 repeat 270..305 CDD:293791 13/25 (52%)
WD40 repeat 311..346 CDD:293791
WD40 repeat 352..392 CDD:293791
WD40 repeat 399..426 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.