DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk12 and SGV1

DIOPT Version :9

Sequence 1:NP_001262167.1 Gene:Cdk12 / 40385 FlyBaseID:FBgn0037093 Length:1157 Species:Drosophila melanogaster
Sequence 2:NP_015487.1 Gene:SGV1 / 856290 SGDID:S000006365 Length:657 Species:Saccharomyces cerevisiae


Alignment Length:437 Identity:152/437 - (34%)
Similarity:231/437 - (52%) Gaps:72/437 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   737 PPVIPGSEELSGDDDVIDSPEDFDAPAVGTVHGHGGGPGTTRQRPVILNRRDSRNNV-------- 793
            |.|:|.:|              |:...:|.|          :..|.|  :||::.|:        
Yeast     7 PAVLPKTE--------------FNKYKIGKV----------KSTPAI--QRDAKTNLTYIKLRKR 45

  Fly   794 ---RDWGERCVDVFE----MIAQIGEGTYGQVYKARDHHTNDMVALKKVRLEHEKEGFPITAVRE 851
               :.:|  |. ||:    ...::|:||:|:|||.....|...||:||:.:..||:.|||||.||
Yeast    46 SSEKVYG--CT-VFQNHYREDEKLGQGTFGEVYKGIHLETQRQVAMKKIIVSVEKDLFPITAQRE 107

  Fly   852 IKILRQLNHRNIVNLHEIVTDKQ----DAVEFRKDKGSFYLVFEYMDHDLMGLLESGMVDFNEEN 912
            |.||::|||:||:.|.|:|.|..    :|......| |||::..||..||.|:|.:..::....:
Yeast   108 ITILKRLNHKNIIKLIEMVYDHSPDITNAASSNLHK-SFYMILPYMVADLSGVLHNPRINLEMCD 171

  Fly   913 NASIMKQLLDGLNYCHKKNFLHRDIKCSNILMNNRGKVKLADFGLARLYNA--DDRERP------ 969
            ..::|.|:|:||||.|...|:|||||.:|||:::.|.:|||||||||||..  .:.:.|      
Yeast   172 IKNMMLQILEGLNYIHCAKFMHRDIKTANILIDHNGVLKLADFGLARLYYGCPPNLKYPGGAGSG 236

  Fly   970 --YTNKVITLWYRPPELLLGEERYGPSIDVWSCGCILGELFVKRPLFQANAEMAQLETISKICGS 1032
              ||:.|:|.|||.|||:||:::|..::|:|..||:..|.|.|:|:.|...::.|...|.|:.|:
Yeast   237 AKYTSVVVTRWYRAPELVLGDKQYTTAVDIWGVGCVFAEFFEKKPILQGKTDIDQGHVIFKLLGT 301

  Fly  1033 PVPAVWPNVIKLP--LFHTLKQKKTHRRRLREDF-EFMPAPALDLLDKMLDLDPDKRITAEDALR 1094
            |....|.....||  ...|...|.|    |||.| :::....||.|.::|.|||.||:||..|..
Yeast   302 PTEEDWAVARYLPGAELTTTNYKPT----LRERFGKYLSETGLDFLGQLLALDPYKRLTAMSAKH 362

  Fly  1095 SPWLRKINPDEMPTPQ--LPTWQDCHELWSKKRRRQMREQQESLPPT 1139
            .||.::   |.:|:.:  ||| ::.||...|:.:.:|.:......||
Yeast   363 HPWFKE---DPLPSEKITLPT-EESHEADIKRYKEEMHQSLSQRVPT 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk12NP_001262167.1 STKc_CDK12 796..1098 CDD:270847 128/322 (40%)
S_TKc 804..1098 CDD:214567 125/314 (40%)
SGV1NP_015487.1 STKc_BUR1 50..366 CDD:270849 128/323 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0600
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000444
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R186
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.