DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk12 and AT1G74330

DIOPT Version :9

Sequence 1:NP_001262167.1 Gene:Cdk12 / 40385 FlyBaseID:FBgn0037093 Length:1157 Species:Drosophila melanogaster
Sequence 2:NP_177573.2 Gene:AT1G74330 / 843774 AraportID:AT1G74330 Length:699 Species:Arabidopsis thaliana


Alignment Length:475 Identity:164/475 - (34%)
Similarity:236/475 - (49%) Gaps:51/475 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   668 KQPLLVPP-------FSASKNNIKPKSLTSLPLPPGMNVLDLAGARSPSPGQKKESDEKNVTS-S 724
            ||.:.|.|       |..::|.........:..||...:..|...||.|..::.:.....:.| |
plant     7 KQTVSVTPAIDHSGVFKDNENECSGSGRIVVEDPPRPTLKKLVSWRSRSGKRRSQKSGSELGSES 71

  Fly   725 GSANKSVLNLPMPPVIPGSEELSGDDDVIDSPEDFDAPAVGTVHGHGGGPGTTRQRPVILNRRDS 789
            |.|:.| |:..:..|   |..|..:......|......|...:||                    
plant    72 GRASDS-LSFRLGNV---SRYLEAEQVAAGWPAWLSNVAGEAIHG-------------------- 112

  Fly   790 RNNVRDWGERCVDVFEMIAQIGEGTYGQVYKARDHHTNDMVALKKVRLEH-EKEGFPITAVREIK 853
                  |.....|.||.:.:||:|||..|::|.:..|..:|||||||.:: |.|.....| |||.
plant   113 ------WVPLRSDAFEKLEKIGQGTYSNVFRAVETETGRIVALKKVRFDNFEPESVKFMA-REIL 170

  Fly   854 ILRQLNHRNIVNLHEIVTDKQDAVEFRKDKGSFYLVFEYMDHDLMGLLESGMVDFNEENNASIMK 918
            |||:|||.||:.|..::|.|...        :..||||||:|||.|||.|..:.|........||
plant   171 ILRRLNHPNIIKLEGLITSKLSC--------NIQLVFEYMEHDLTGLLSSPDIKFTTPQIKCYMK 227

  Fly   919 QLLDGLNYCHKKNFLHRDIKCSNILMNNRGKVKLADFGLARLYNAD-DRERPYTNKVITLWYRPP 982
            |||.||::||.:..:|||||.||:|::|.|.:|:||||||...|:. .:::|.|::|:|||||||
plant   228 QLLSGLDHCHSRGVMHRDIKGSNLLLSNEGILKVADFGLANFSNSSGHKKKPLTSRVVTLWYRPP 292

  Fly   983 ELLLGEERYGPSIDVWSCGCILGELFVKRPLFQANAEMAQLETISKICGSPVPAVWPNVIKLPLF 1047
            |||||...||.|:|:||.||:..||.:.:|:.:...|:.||..|.|:||||....|.. .|||..
plant   293 ELLLGATDYGASVDLWSVGCVFAELLLGKPILRGRTEVEQLHKIFKLCGSPPEDYWKK-SKLPHA 356

  Fly  1048 HTLKQKKTHRRRLREDFEFMPAPALDLLDKMLDLDPDKRITAEDALRSPWLRKINPDEMPTPQLP 1112
            ...|.::|:...|||..:.:....::|::.:|.:||.||.||..||.|.:. ...|.......||
plant   357 MLFKPQQTYDSCLRETLKDLSETEINLIETLLSIDPHKRGTASSALVSQYF-TTKPFACDPSSLP 420

  Fly  1113 TWQDCHELWSKKRRRQMREQ 1132
            .:....|:.:|.|....|::
plant   421 IYPPSKEIDTKHRDEAARKK 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk12NP_001262167.1 STKc_CDK12 796..1098 CDD:270847 132/303 (44%)
S_TKc 804..1098 CDD:214567 130/295 (44%)
AT1G74330NP_177573.2 STKc_CDK9_like 121..407 CDD:270832 130/295 (44%)
PTZ00024 127..420 CDD:240233 129/303 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0600
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2442
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24056
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.