DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk12 and AT5G50860

DIOPT Version :9

Sequence 1:NP_001262167.1 Gene:Cdk12 / 40385 FlyBaseID:FBgn0037093 Length:1157 Species:Drosophila melanogaster
Sequence 2:NP_199899.1 Gene:AT5G50860 / 835158 AraportID:AT5G50860 Length:580 Species:Arabidopsis thaliana


Alignment Length:440 Identity:155/440 - (35%)
Similarity:230/440 - (52%) Gaps:43/440 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   708 PSPGQKKESDEKNVTSSGSANKSVLNLPMPPVIPGSEELSGDDDVIDSPE-------DFDAPAVG 765
            |.|...:.:::  :.||.|...:.:::.:     |.::....|.:...||       ||.|    
plant    22 PPPADLRNTED--LPSSSSTTTAAISVEI-----GEKKKKDLDSIQIQPERRTWHTGDFSA---- 75

  Fly   766 TVHGHGGGPGTTRQRP------VILNRRDSRNNVRDWGERCVDVFEMIAQIGEGTYGQVYKARDH 824
               |....||.:.:.|      :|....||   ::|...|....:|.:.:||:|||..||||:|.
plant    76 ---GSSRRPGMSLRTPEGWPPWLIAACGDS---IKDLTPRRATTYEKLEKIGQGTYSNVYKAKDL 134

  Fly   825 HTNDMVALKKVRLEH-EKEGFPITAVREIKILRQLNHRNIVNLHEIVTDKQDAVEFRKDKGSFYL 888
            .:..:|||||||.:: |.|.....| |||.:||:|||.|::.|..:||.:...        |.||
plant   135 LSGKIVALKKVRFDNLEAESVKFMA-REILVLRRLNHPNVIKLQGLVTSRVSC--------SLYL 190

  Fly   889 VFEYMDHDLMGLLESGMVDFNEENNASIMKQLLDGLNYCHKKNFLHRDIKCSNILMNNRGKVKLA 953
            |||||:|||.||..:..:.|:.......|||||.||.:||.:..||||||.||:|::|.|.:|:|
plant   191 VFEYMEHDLSGLAATQGLKFDLPQVKCFMKQLLSGLEHCHSRGVLHRDIKGSNLLIDNDGILKIA 255

  Fly   954 DFGLARLYNADDRERPYTNKVITLWYRPPELLLGEERYGPSIDVWSCGCILGELFVKRPLFQANA 1018
            |||||..|:...:: ..|::|:||||||||||||...||..:|:||.|||:.||...:|:.....
plant   256 DFGLATFYDPKQKQ-TMTSRVVTLWYRPPELLLGATSYGTGVDLWSAGCIMAELLAGKPVMPGRT 319

  Fly  1019 EMAQLETISKICGSPVPAVWPNVIKLPLFHTLKQKKTHRRRLREDFEFMPAPALDLLDKMLDLDP 1083
            |:.||..|.|:||||..:.|.. .:||.....|.:..::|.:.|.|......::.|::.:|.:||
plant   320 EVEQLHKIFKLCGSPSDSYWKK-YRLPNATLFKPQHPYKRCVAEAFNGFTPSSVHLVETLLTIDP 383

  Fly  1084 DKRITAEDALRSPWLRKINPDEMPTPQLPTWQDCHELWSKKRRRQMREQQ 1133
            ..|.|:..||.|.:. ...|.......||.:....||..|.|..::|.|:
plant   384 ADRGTSTSALNSEFF-TTEPLPCDPSSLPKYPPSKELNVKLRDEELRRQK 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk12NP_001262167.1 STKc_CDK12 796..1098 CDD:270847 126/302 (42%)
S_TKc 804..1098 CDD:214567 125/294 (43%)
AT5G50860NP_199899.1 STKc_CDK9_like 114..398 CDD:270832 125/294 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0600
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.