DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk12 and CDKC;1

DIOPT Version :9

Sequence 1:NP_001262167.1 Gene:Cdk12 / 40385 FlyBaseID:FBgn0037093 Length:1157 Species:Drosophila melanogaster
Sequence 2:NP_196589.1 Gene:CDKC;1 / 830891 AraportID:AT5G10270 Length:505 Species:Arabidopsis thaliana


Alignment Length:372 Identity:182/372 - (48%)
Similarity:238/372 - (63%) Gaps:23/372 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   796 WGERCVDVFEMIAQIGEGTYGQVYKARDHHTNDMVALKKVRLEHEKEGFPITAVREIKILRQLNH 860
            ||.|.||.||.:.|||||||||||.|::..|.::|||||:|:::|:|||||||:||||||::|:|
plant    18 WGSRSVDCFEKLEQIGEGTYGQVYMAKEIKTGEIVALKKIRMDNEREGFPITAIREIKILKKLHH 82

  Fly   861 RNIVNLHEIVT------DKQDAVEFRKDKGSFYLVFEYMDHDLMGLLESGMVDFNEENNASIMKQ 919
            .|::.|.||||      |.|...:..|.||..|:|||||||||.||.:...:.|........|||
plant    83 ENVIQLKEIVTSPGRDRDDQGKPDNNKYKGGIYMVFEYMDHDLTGLADRPGLRFTVPQIKCYMKQ 147

  Fly   920 LLDGLNYCHKKNFLHRDIKCSNILMNNRGKVKLADFGLARLYNADDRERPYTNKVITLWYRPPEL 984
            ||.||:|||....||||||.||:|::|.|.:|||||||||.| :.|.....||:|||||||||||
plant   148 LLTGLHYCHVNQVLHRDIKGSNLLIDNEGNLKLADFGLARSY-SHDHTGNLTNRVITLWYRPPEL 211

  Fly   985 LLGEERYGPSIDVWSCGCILGELFVKRPLFQANAEMAQLETISKICGSPVPAVWPNVIKLPLFHT 1049
            |||..:|||:||:||.|||..||...:|:.....|..||..|.::||||...:||.|.|:|.|:.
plant   212 LLGATKYGPAIDMWSVGCIFAELLHAKPILPGKNEQEQLNKIFELCGSPDEKLWPGVSKMPWFNN 276

  Fly  1050 LKQKKTHRRRLREDFEFMPAPALDLLDKMLDLDPDKRITAEDALRSP--WLRKINPDEMP--TPQ 1110
            .|..:..:||:||.|......||:||:|||.|||.:||:|:|||.:.  |     .|.:|  ...
plant   277 FKPARPLKRRVREFFRHFDRHALELLEKMLVLDPAQRISAKDALDAEYFW-----TDPLPCDPKS 336

  Fly  1111 LPTWQDCHELWSKKRRRQMREQQESL-------PPTVIASTKYQQHG 1150
            |||::..||..:||:|:|.|:.:|:.       ||...:.....|||
plant   337 LPTYESSHEFQTKKKRQQQRQNEEAAKRQKLQHPPLQHSRLPPLQHG 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk12NP_001262167.1 STKc_CDK12 796..1098 CDD:270847 163/309 (53%)
S_TKc 804..1098 CDD:214567 158/301 (52%)
CDKC;1NP_196589.1 STKc_CDK9_like 26..325 CDD:270832 158/299 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 309 1.000 Domainoid score I316
eggNOG 1 0.900 - - E1_KOG0600
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 1 1.000 - - FOG0000444
OrthoInspector 1 1.000 - - otm2442
orthoMCL 1 0.900 - - OOG6_101677
Panther 1 1.100 - - O PTHR24056
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X546
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.