DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk12 and AT3G01085

DIOPT Version :9

Sequence 1:NP_001262167.1 Gene:Cdk12 / 40385 FlyBaseID:FBgn0037093 Length:1157 Species:Drosophila melanogaster
Sequence 2:NP_001325617.1 Gene:AT3G01085 / 821283 AraportID:AT3G01085 Length:631 Species:Arabidopsis thaliana


Alignment Length:466 Identity:153/466 - (32%)
Similarity:226/466 - (48%) Gaps:58/466 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   685 PKSLTSLPLPPG-MNVLDLAGARSPSPGQKKESDEKNVTSSGSANKSVL---NLPMPPVIPGSEE 745
            |.:...||.||. ..|::    .||...:..:.|.....::|.:.:|.|   |:....|..|   
plant    34 PHNRHVLPGPPSHRRVVN----SSPKKHRNNDDDAPKSRTTGVSLRSGLPHSNVEAEQVAAG--- 91

  Fly   746 LSGDDDVIDSPEDFDAPAVGTVHGHGGGPGTTRQRPVILNRRDSRNNVRDWGERCVDVFEMIAQI 810
                     .|....:.|...|||                          |.....:.||...:|
plant    92 ---------WPSWLSSAAPEAVHG--------------------------WVPLRAEDFEKREKI 121

  Fly   811 GEGTYGQVYKARDHHTNDMVALKKVRLEH-EKEGFPITAVREIKILRQLNHRNIVNLHEIVTDKQ 874
            |:|||..|::|.:..|..::||||:|::: |.|.....| |||.|||:|:|.||:.|..|:..  
plant   122 GQGTYSNVFRACEVSTGRVMALKKIRIQNFETENIRFIA-REIMILRRLDHPNIMKLEGIIAS-- 183

  Fly   875 DAVEFRKDKGSFYLVFEYMDHDLMGLLESGMVDFNEENNASIMKQLLDGLNYCHKKNFLHRDIKC 939
                  ::..|.|.||:||:|||.||..|..:.|.|......|||||.|:.:||.:..:|||||.
plant   184 ------RNSNSMYFVFDYMEHDLEGLCSSPDIKFTEAQIKCYMKQLLWGVEHCHLRGIMHRDIKA 242

  Fly   940 SNILMNNRGKVKLADFGLARLYNADDRERPYTNKVITLWYRPPELLLGEERYGPSIDVWSCGCIL 1004
            :|||:||:|.:||||||||.:....::.: .|::|:|||||.||||:|...|..|:|:||.||:.
plant   243 ANILVNNKGVLKLADFGLANIVTPRNKNQ-LTSRVVTLWYRAPELLMGSTSYSVSVDLWSVGCVF 306

  Fly  1005 GELFVKRPLFQANAEMAQLETISKICGSPVPAVWPNVIKLPLFHTLKQKKTHRRRLREDFEFMPA 1069
            .|:...|||.:...|:.||..|.|:.|||....|......|.....:.:..:...|||.|:..|.
plant   307 AEILTGRPLLKGRTEIEQLHKIYKLSGSPDEEFWEKNKLHPQTKMFRPQHQYEGCLRERFDEFPK 371

  Fly  1070 PALDLLDKMLDLDPDKRITAEDALRSPWLRKINPDEMPTPQLPTWQDCHELWSKKRRRQMREQQE 1134
            .|::||:.:|.:||:||.||..||.|.:. ...|.......||.:....|:.:|.|....|.::.
plant   372 TAINLLENLLSIDPEKRGTASSALMSEYF-NTQPYACDPSTLPKYPPNKEMDAKYREELQRRRRV 435

  Fly  1135 SLPPTVIASTK 1145
            |:......:||
plant   436 SIKKRDNLATK 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk12NP_001262167.1 STKc_CDK12 796..1098 CDD:270847 123/302 (41%)
S_TKc 804..1098 CDD:214567 122/294 (41%)
AT3G01085NP_001325617.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0600
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24056
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.