DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk12 and Cdk2

DIOPT Version :9

Sequence 1:NP_001262167.1 Gene:Cdk12 / 40385 FlyBaseID:FBgn0037093 Length:1157 Species:Drosophila melanogaster
Sequence 2:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster


Alignment Length:318 Identity:130/318 - (40%)
Similarity:186/318 - (58%) Gaps:26/318 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   801 VDVFEMIAQIGEGTYGQVYKARDHHTNDMVALKKVRLEHEKEGFPITAVREIKILRQLNHRNIVN 865
            :|.|:...:|||||||.|||||.:.|...|||||:|||.|.||.|.||:|||.:|:.|.|.|:|.
  Fly     5 LDNFQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNLKHPNVVQ 69

  Fly   866 LHEIVTDKQDAVEFRKDKGSFYLVFEYMDHDLMGLLESGMVDFNEENNASIMKQLLDGLNYCHKK 930
            |.::|.          ...:.|::|||::.||..|::.....|..:...|.|.|:||.:.:||..
  Fly    70 LFDVVI----------SGNNLYMIFEYLNMDLKKLMDKKKDVFTPQLIKSYMHQILDAVGFCHTN 124

  Fly   931 NFLHRDIKCSNILMNNRGKVKLADFGLARLYNADDRERPYTNKVITLWYRPPELLLGEERYGPSI 995
            ..||||:|..|:|::..||:|||||||||.:|..  .|.||::|:|||||.||:|||.:.|...:
  Fly   125 RILHRDLKPQNLLVDTAGKIKLADFGLARAFNVP--MRAYTHEVVTLWYRAPEILLGTKFYSTGV 187

  Fly   996 DVWSCGCILGELFVKRPLFQANAEMAQLETISKICGSPVPAVWPNVIKLPLFHTLKQKKTHRRRL 1060
            |:||.|||..|:.::|.||..::|:.||..|.:...:|....||.|.:||.|.|        :..
  Fly   188 DIWSLGCIFSEMIMRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLPDFKT--------KFP 244

  Fly  1061 REDFEFMPAP-----ALDLLDKMLDLDPDKRITAEDALRSPWLRKI-NPDEMPTPQLP 1112
            |.:...||.|     |.:|:..||..||:.||:|:|||:..:.|.: :.|.:..|..|
  Fly   245 RWEGTNMPQPITEHEAHELIMSMLCYDPNLRISAKDALQHAYFRNVQHVDHVALPVDP 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk12NP_001262167.1 STKc_CDK12 796..1098 CDD:270847 126/301 (42%)
S_TKc 804..1098 CDD:214567 125/298 (42%)
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 127/307 (41%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 125/298 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442460
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.