DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk12 and Cdk4

DIOPT Version :9

Sequence 1:NP_001262167.1 Gene:Cdk12 / 40385 FlyBaseID:FBgn0037093 Length:1157 Species:Drosophila melanogaster
Sequence 2:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster


Alignment Length:324 Identity:114/324 - (35%)
Similarity:184/324 - (56%) Gaps:26/324 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   786 RRDSRNNVRDWGERCVDVFEMIAQIGEGTYGQVYKARDHHTNDMVALKKVRLEHEKEGFPITAVR 850
            :|...:..:.:|:.....::.:..||||.||.||:|||..|.::|||||||:...:.|.|::.:|
  Fly     8 KRQKMSQAKKFGDGDPFNYQELNIIGEGAYGTVYRARDVITGNIVALKKVRISLNENGVPMSTLR 72

  Fly   851 EIKILRQL---NHRNIVNLHEIVTDKQDAVEFRKDKGS--FYLVFEYMDHDLMGLLE----SGMV 906
            ||.:|:||   ||.|||.|:|:       .:|.:..|.  ..||||:::.||..|::    ||| 
  Fly    73 EISLLKQLNASNHANIVKLYEV-------CQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSGM- 129

  Fly   907 DFNEENNASIMKQLLDGLNYCHKKNFLHRDIKCSNILMNNRGKVKLADFGLARLYNADDRERPYT 971
              :......:.::||.|:::.|....:|||:|..|:|::::|.:|:||||||:.|.:   |...|
  Fly   130 --SPPTIQRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLAKTYGS---EMKLT 189

  Fly   972 NKVITLWYRPPELLLGEERYGPSIDVWSCGCILGELFVKRPLFQANAEMAQLETISKICGSPVPA 1036
            :.|:|||||.||:||.:. |..::|:||..||:.|:|.:|.||...:|..||:.|.::.|.|...
  Fly   190 SVVVTLWYRAPEVLLAQP-YNSTVDIWSAACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQ 253

  Fly  1037 VWPNVIKLPLFHTLKQKKTHRRRLREDFEFMPAPALDLLDKMLDLDPDKRITAEDALRSPWLRK 1100
            .||..|.:.|.|.   .:.|.:|.::....:...|.|||:|||..|...|.:|...|...:.::
  Fly   254 QWPQTISVALEHF---PQRHPKRPKDFCPHLCKYADDLLNKMLSYDLHLRPSALACLEHDYFQQ 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk12NP_001262167.1 STKc_CDK12 796..1098 CDD:270847 113/310 (36%)
S_TKc 804..1098 CDD:214567 112/302 (37%)
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 112/302 (37%)
S_TKc 26..312 CDD:214567 112/302 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442455
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.