DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk12 and Cdk1

DIOPT Version :9

Sequence 1:NP_001262167.1 Gene:Cdk12 / 40385 FlyBaseID:FBgn0037093 Length:1157 Species:Drosophila melanogaster
Sequence 2:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster


Alignment Length:300 Identity:119/300 - (39%)
Similarity:180/300 - (60%) Gaps:23/300 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   804 FEMIAQIGEGTYGQVYKARDHHTNDMVALKKVRLEHEKEGFPITAVREIKILRQLNHRNIVNLHE 868
            ||.|.:|||||||.|||.|:..|..:||:||:|||.:.||.|.||:|||.:|::|.|.|||.|.:
  Fly     4 FEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVCLED 68

  Fly   869 IVTDKQDAVEFRKDKGSFYLVFEYMDHDLMGLLESGMVDFNEENN--ASIMKQLLDGLNYCHKKN 931
            ::          .::...||:||::..||...::|..||.:.|:.  .|.:.|:...:.:||::.
  Fly    69 VL----------MEENRIYLIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHRRR 123

  Fly   932 FLHRDIKCSNILMNNRGKVKLADFGLARLYNADDRERPYTNKVITLWYRPPELLLGEERYGPSID 996
            .||||:|..|:|::..|.:|:|||||.|.:...  .|.||::::|||||.||:|||..||...:|
  Fly   124 VLHRDLKPQNLLIDKSGLIKVADFGLGRSFGIP--VRIYTHEIVTLWYRAPEVLLGSPRYSCPVD 186

  Fly   997 VWSCGCILGELFVKRPLFQANAEMAQLETISKICGSPVPAVWPNVIKLPLFHTLKQKKT----HR 1057
            :||.|||..|:..::||||.::|:.||..:.:|..:|...:||.|..||.:     |.|    ..
  Fly   187 IWSIGCIFAEMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDY-----KNTFPCWST 246

  Fly  1058 RRLREDFEFMPAPALDLLDKMLDLDPDKRITAEDALRSPW 1097
            .:|....:.:.|..:||:.|||..||..||:|:|.|..|:
  Fly   247 NQLTNQLKNLDANGIDLIQKMLIYDPVHRISAKDILEHPY 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk12NP_001262167.1 STKc_CDK12 796..1098 CDD:270847 119/299 (40%)
S_TKc 804..1098 CDD:214567 119/299 (40%)
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 119/299 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442461
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.