DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk12 and Cdk7

DIOPT Version :9

Sequence 1:NP_001262167.1 Gene:Cdk12 / 40385 FlyBaseID:FBgn0037093 Length:1157 Species:Drosophila melanogaster
Sequence 2:NP_511044.1 Gene:Cdk7 / 31441 FlyBaseID:FBgn0263237 Length:353 Species:Drosophila melanogaster


Alignment Length:336 Identity:113/336 - (33%)
Similarity:175/336 - (52%) Gaps:46/336 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   792 NVRDWGERCVDVFEMIAQIGEGTYGQVYKARDHHTNDMVALKKVR---LEHEKEGFPITAVREIK 853
            |..|..||    :..::.:|||.:..||||||..||.:||:||::   .|..::|...||:||||
  Fly     4 NANDKTER----YAKLSFLGEGQFATVYKARDTVTNQIVAVKKIKKGSREDARDGINRTALREIK 64

  Fly   854 ILRQLNHRNIVNLHEIVTDKQDAVEFRKDKGSFYLVFEYMDHDLMGLLESGMVDFNEENNASIMK 918
            ||::|.|.||:.|          |:......:..|||::||.||..:::...:...:.|..:...
  Fly    65 ILQELQHENIIGL----------VDVFGQLSNVSLVFDFMDTDLEVIIKDNKIILTQANIKAYAI 119

  Fly   919 QLLDGLNYCHKKNFLHRDIKCSNILMNNRGKVKLADFGLARLYNADDRERPYTNKVITLWYRPPE 983
            ..|.||.|.|....||||:|.:|:|:|:.|.:|:.|||||:.:.:.:  |.||:.|:|.|||.||
  Fly   120 MTLKGLEYLHLNWILHRDLKPNNLLVNSDGILKIGDFGLAKSFGSPN--RIYTHHVVTRWYRSPE 182

  Fly   984 LLLGEERYGPSIDVWSCGCILGELFVKRPLFQANAEMAQLETISKICGSPVPAVWPNVIKLPLFH 1048
            ||.|..:||..:|:|:.||||.||.::.|....::::.||..|....|:|..|.||::.||   |
  Fly   183 LLFGARQYGTGVDMWAVGCILAELMLRVPFMPGDSDLDQLTRIFSTLGTPTEAEWPHLSKL---H 244

  Fly  1049 TLKQKKTHRRRLREDFEFMPAPALD------------LLDKMLDLDPDKRITAEDALRSPWLRKI 1101
            ...|           |...|...||            |:.::..::|.:|::..:||..|:... 
  Fly   245 DYLQ-----------FRNFPGTPLDNIFTAAGNDLIHLMQRLFAMNPLRRVSCREALSMPYFAN- 297

  Fly  1102 NPDEMPTPQLP 1112
            .|.....|:||
  Fly   298 KPAPTVGPKLP 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk12NP_001262167.1 STKc_CDK12 796..1098 CDD:270847 107/316 (34%)
S_TKc 804..1098 CDD:214567 105/308 (34%)
Cdk7NP_511044.1 PTZ00024 6..308 CDD:240233 110/332 (33%)
STKc_CDK7 11..308 CDD:270833 108/327 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442392
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.