DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk12 and ppk23

DIOPT Version :9

Sequence 1:NP_001262167.1 Gene:Cdk12 / 40385 FlyBaseID:FBgn0037093 Length:1157 Species:Drosophila melanogaster
Sequence 2:NP_595739.1 Gene:ppk23 / 2540799 PomBaseID:SPBC18H10.15 Length:398 Species:Schizosaccharomyces pombe


Alignment Length:314 Identity:130/314 - (41%)
Similarity:183/314 - (58%) Gaps:18/314 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   801 VDVFEMIAQIGEGTYGQVYKARDHHTNDMVALKKVRLEHEKEGFPITAVREIKILRQLNHRNIVN 865
            :|.:|::.:|.||:||.||:..|..||.:|||||::.:....|||||::|||:.|..:.|.|||.
pombe    71 IDDYEILEKIEEGSYGIVYRGLDKSTNTLVALKKIKFDPNGIGFPITSLREIESLSSIRHDNIVE 135

  Fly   866 LHEIVTDKQDAVEFRKDKGSFYLVFEYMDHDLMGLLESGMVDFNEENNASIMKQLLDGLNYCHKK 930
            |.::|..        ||....|||.|:|:|||..||::...||.:....::|.|||....:.|..
pombe   136 LEKVVVG--------KDLKDVYLVMEFMEHDLKTLLDNMPEDFLQSEVKTLMLQLLAATAFMHHH 192

  Fly   931 NFLHRDIKCSNILMNNRGKVKLADFGLARLYNADDRERPYTNKVITLWYRPPELLLGEERYGPSI 995
            .:||||:|.||:||||.|::|||||||||  ...:.:...|..|:|||||.||||||...||..|
pombe   193 WYLHRDLKPSNLLMNNTGEIKLADFGLAR--PVSEPKSSLTRLVVTLWYRAPELLLGAPSYGKEI 255

  Fly   996 DVWSCGCILGELFVKRPLFQANAEMAQLETISKICGSPVPAVWPNVIKLPLFHTLKQK--KTHRR 1058
            |:||.|||..|:..:.|||...:|:.||..|..:.|.|....||....||..:.:|..  .|| .
pombe   256 DMWSIGCIFAEMITRTPLFSGKSELDQLYKIFNLLGYPTREEWPQYFLLPYANKIKHPTVPTH-S 319

  Fly  1059 RLREDFEFMPAPALDLLDKMLDLDPDKRITAEDALRSPWLRKINPDEMPTPQLP 1112
            ::|.....:...|.|||:::|.|:|.|||:|::||..|:..     |.|.|:.|
pombe   320 KIRTSIPNLTGNAYDLLNRLLSLNPAKRISAKEALEHPYFY-----ESPRPKDP 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk12NP_001262167.1 STKc_CDK12 796..1098 CDD:270847 126/298 (42%)
S_TKc 804..1098 CDD:214567 125/295 (42%)
ppk23NP_595739.1 STKc_CDC2L1 68..359 CDD:173741 126/298 (42%)
PLN00009 71..361 CDD:177649 126/305 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.