DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk12 and Cdk10

DIOPT Version :9

Sequence 1:NP_001262167.1 Gene:Cdk12 / 40385 FlyBaseID:FBgn0037093 Length:1157 Species:Drosophila melanogaster
Sequence 2:NP_919428.1 Gene:Cdk10 / 234854 MGIID:2448549 Length:360 Species:Mus musculus


Alignment Length:314 Identity:136/314 - (43%)
Similarity:187/314 - (59%) Gaps:14/314 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   799 RCVDVFEMIAQIGEGTYGQVYKARDHHTNDMVALKKVRLEHEKEGFPITAVREIKILRQLNHRNI 863
            |.|..||.:.:|||||||.||:|||..|:::|||||||::.||:|.||:::|||.:|.:|.|.||
Mouse    34 RSVKEFEKLNRIGEGTYGIVYRARDTQTDEIVALKKVRMDKEKDGIPISSLREITLLLRLRHPNI 98

  Fly   864 VNLHEIVTDKQDAVEFRKDKGSFYLVFEYMDHDLMGLLESGMVDFNEENNASIMKQLLDGLNYCH 928
            |.|.|:|....  :|      |.:||..|.:.||..|||:....|:|.....||.|:|.||.|.|
Mouse    99 VELKEVVVGNH--LE------SIFLVMGYCEQDLASLLENMPTPFSEAQVKCIMLQVLRGLQYLH 155

  Fly   929 KKNFLHRDIKCSNILMNNRGKVKLADFGLARLYNADDRERPYTNKVITLWYRPPELLLGEERYGP 993
            :...:|||:|.||:||.::|.||.|||||||.|...  .:|.|.||:|||||.||||||......
Mouse   156 RNFIIHRDLKVSNLLMTDKGCVKTADFGLARAYGVP--VKPMTPKVVTLWYRAPELLLGTTTQTT 218

  Fly   994 SIDVWSCGCILGELFVKRPLFQANAEMAQLETISKICGSPVPAVWPNVIKLPLFHTLKQKKTHRR 1058
            |||:|:.||||.||...:||....:|:.|::.|.::.|:|...:||...||||......:|....
Mouse   219 SIDMWAVGCILAELLAHKPLLPGTSEIHQIDLIVQLLGTPSENIWPGFSKLPLAGQYSLRKQPYN 283

  Fly  1059 RLREDFEFMPAPALDLLDKMLDLDPDKRITAEDALRSPWLRK----INPDEMPT 1108
            .|:..|.::....|.||:.:...||.||.|:.|.|.|.:.::    ..|:.|||
Mouse   284 NLKHKFPWLSEAGLRLLNFLFMYDPKKRATSGDCLESSYFKEKPLPCEPELMPT 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk12NP_001262167.1 STKc_CDK12 796..1098 CDD:270847 132/298 (44%)
S_TKc 804..1098 CDD:214567 130/293 (44%)
Cdk10NP_919428.1 STKc_CDK10 31..339 CDD:173742 136/314 (43%)
PTZ00024 43..336 CDD:240233 129/302 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 334..360 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.