DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SAK and Plk3

DIOPT Version :9

Sequence 1:NP_649324.1 Gene:SAK / 40384 FlyBaseID:FBgn0026371 Length:769 Species:Drosophila melanogaster
Sequence 2:NP_071523.1 Gene:Plk3 / 58936 RGDID:62039 Length:647 Species:Rattus norvegicus


Alignment Length:417 Identity:134/417 - (32%)
Similarity:203/417 - (48%) Gaps:49/417 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLSNRAFGETIEDYEVQHLLGKGGFATVYKARCLHTHQDVAIKMIDKKLIQGTGLTNRVRQEVEI 65
            ::::...|.|   |....||||||||..|:|....|....|:|:|.:..:.......::..|:|:
  Rat    52 LITDPRSGRT---YIKGRLLGKGGFARCYEATDTETSIAYAVKVIPQSRVAKPHQREKIINEIEL 113

  Fly    66 HSRLKHPSVLQLYTFFQDANYVYLVLELAHNGELHRYMNHI--AR-PFTETEAASILKQVVAGLL 127
            |..|:|..:::....|:||:.:|:.|||..    .:.:.||  || ...|.|....|:|:::||.
  Rat   114 HRDLQHRHIVRFSHHFEDADNIYIFLELCS----RKSLAHIWKARHTLLEPEVRYYLRQILSGLK 174

  Fly   128 YLHSHNIMHRDISLSNLLLSREMHVKIADFGLATQLKRPDERHMTMCGTPNYISPEVVSRTSHGL 192
            |||...|:|||:.|.|..::..|.:|:.|||||.:|:.|::|..|:||||||::|||:.|..||.
  Rat   175 YLHQRGILHRDLKLGNFFITDNMELKVGDFGLAARLEPPEQRKKTICGTPNYVAPEVLLRQGHGP 239

  Fly   193 PADVWSVGCMLYTLLVGRPPFETDAVQSTLNKVVMSEYIMPAHLSYEAQDLINKLLKKLPHERIT 257
            .|||||:||::||||.|.|||||..::.|...:....|.:||.||..|:.|:..:|:..|.:|.:
  Rat   240 EADVWSLGCVMYTLLCGSPPFETADLKETYRCIKQVHYTLPASLSLPARQLLAAILRASPRDRPS 304

  Fly   258 LEAVLCHPFMLK-----------CSNGGHSAP--GALNVFSQSMESGDSGIITFASSDSRNSQQI 309
            :|.:|.|.|..|           |.......|  .|.::|::..:|      .|....|:|....
  Rat   305 IEQILRHDFFTKGYTPDRLPVSSCVTVPDLTPPNPARSLFAKVTKS------LFGRRKSKNKNHS 363

  Fly   310 RSVEN-----SGPQQVL---PQIREEFKQVHHKLPYEQTGLFGQASTGLAEPNWP-GAAKSSAFC 365
            ...:|     ||..:..   |.:|.|........|   ..|...|    ||.:.| |...||...
  Rat   364 EEQDNVSCLVSGLMRTSIGHPDVRPEAPAASALAP---VSLVETA----AEDSSPRGTLASSGDG 421

  Fly   366 MEAG----NVPNSKQASLKEDRISVPP 388
            .|.|    .|..|...:|:.....:||
  Rat   422 FEEGLTVTTVVESALCALRNCVAFMPP 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SAKNP_649324.1 STKc_PLK4 12..267 CDD:271088 100/257 (39%)
S_TKc 14..267 CDD:214567 100/255 (39%)
POLO_box_Plk4_1 382..497 CDD:240557 2/7 (29%)
POLO_box_Plk4_2 498..596 CDD:240558
POLO_box_Plk4_3 657..738 CDD:240559
Plk3NP_071523.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56 0/3 (0%)
STKc_PLK3 60..314 CDD:271091 101/260 (39%)
S_TKc 62..314 CDD:214567 100/255 (39%)
POLO_box_1 461..549 CDD:240561
POLO_box_2 562..629 CDD:240560
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0575
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D507604at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.