DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SAK and Plk3

DIOPT Version :9

Sequence 1:NP_649324.1 Gene:SAK / 40384 FlyBaseID:FBgn0026371 Length:769 Species:Drosophila melanogaster
Sequence 2:NP_038835.2 Gene:Plk3 / 12795 MGIID:109604 Length:648 Species:Mus musculus


Alignment Length:420 Identity:135/420 - (32%)
Similarity:202/420 - (48%) Gaps:60/420 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GETIED------YEVQHLLGKGGFATVYKARCLHTHQDVAIKMIDKKLIQGTGLTNRVRQEVEIH 66
            |..|.|      |....||||||||..|:|....:....|:|:|.:..:.......::..|:|:|
Mouse    51 GRLITDPLSGRTYTKGRLLGKGGFARCYEATDTESGIAYAVKVIPQSRVAKPHQREKILNEIELH 115

  Fly    67 SRLKHPSVLQLYTFFQDANYVYLVLELAHNGELHRYMNHI--AR-PFTETEAASILKQVVAGLLY 128
            ..|:|..:::....|:||:.:|:.|||..    .:.:.||  || ...|.|....|:|:::||.|
Mouse   116 RDLQHRHIVRFSHHFEDADNIYIFLELCS----RKSLAHIWKARHTLLEPEVRYYLRQILSGLKY 176

  Fly   129 LHSHNIMHRDISLSNLLLSREMHVKIADFGLATQLKRPDERHMTMCGTPNYISPEVVSRTSHGLP 193
            ||...|:|||:.|.|..::..|.:|:.|||||.:|:.|::|..|:||||||::|||:.|..||..
Mouse   177 LHQRGILHRDLKLGNFFITDNMELKVGDFGLAARLEPPEQRKKTICGTPNYVAPEVLLRQGHGPE 241

  Fly   194 ADVWSVGCMLYTLLVGRPPFETDAVQSTLNKVVMSEYIMPAHLSYEAQDLINKLLKKLPHERITL 258
            |||||:||::||||.|.|||||..::.|...:....|.:||.||..|:.|:..:|:..|.:|.::
Mouse   242 ADVWSLGCVMYTLLCGSPPFETADLKETYRCIKQVHYTLPASLSLPARQLLAAILRASPRDRPSI 306

  Fly   259 EAVLCHPFMLK-----------CSNGGHSAP--GALNVFSQSMESGDSGIITFASSDSRNSQQIR 310
            |.:|.|.|..|           |.......|  .|.::|::..:|      .|....::|.....
Mouse   307 EQILRHDFFTKGYTPDRLPVSSCVTVPDLTPPNPARSLFAKVTKS------LFGRKKNKNKNHSE 365

  Fly   311 SVEN-----SGPQQVL---PQIREEFKQVHHKLPYEQTGLFGQASTGL----AEPNWP-GAAKSS 362
            ..:|     ||..:..   |.:|.|...|.           |||...|    ||.:.| |...||
Mouse   366 DQDNVSCLVSGLMRTSIGHPDVRPEAPVVS-----------GQAPASLVETAAEDSSPRGTLASS 419

  Fly   363 AFCMEAG----NVPNSKQASLKEDRISVPP 388
            ....|.|    .|..|...:|:.....:||
Mouse   420 GDGFEEGLTVATVVESALCALRNCVAFMPP 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SAKNP_649324.1 STKc_PLK4 12..267 CDD:271088 100/263 (38%)
S_TKc 14..267 CDD:214567 99/255 (39%)
POLO_box_Plk4_1 382..497 CDD:240557 2/7 (29%)
POLO_box_Plk4_2 498..596 CDD:240558
POLO_box_Plk4_3 657..738 CDD:240559
Plk3NP_038835.2 STKc_PLK3 61..315 CDD:271091 99/257 (39%)
S_TKc 63..315 CDD:214567 99/255 (39%)
POLO_box_1 462..550 CDD:240561
POLO_box_2 563..630 CDD:240560
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0575
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D507604at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.