DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SAK and PLK2

DIOPT Version :9

Sequence 1:NP_649324.1 Gene:SAK / 40384 FlyBaseID:FBgn0026371 Length:769 Species:Drosophila melanogaster
Sequence 2:NP_006613.2 Gene:PLK2 / 10769 HGNCID:19699 Length:685 Species:Homo sapiens


Alignment Length:585 Identity:150/585 - (25%)
Similarity:248/585 - (42%) Gaps:169/585 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLGKGGFATVYKARCLHTHQDVAIKMIDKKLIQGTGLTNRVRQEVEIHSRLKHPSVLQLYTFFQD 83
            :|||||||..|:...|..::..|.|:|....:.......::.:|:|:|..|.|..|:|.|.:|:|
Human    87 VLGKGGFAKCYEMTDLTNNKVYAAKIIPHSRVAKPHQREKIDKEIELHRILHHKHVVQFYHYFED 151

  Fly    84 ANYVYLVLELAHNGELHRYMNHIARP---FTETEAASILKQVVAGLLYLHSHNIMHRDISLSNLL 145
            ...:|::||...    .|.|.||.:.   .||.|....|:|:|:||.|||...|:|||:.|.|..
Human   152 KENIYILLEYCS----RRSMAHILKARKVLTEPEVRYYLRQIVSGLKYLHEQEILHRDLKLGNFF 212

  Fly   146 LSREMHVKIADFGLATQLKRPDERHMTMCGTPNYISPEVVSRTSHGLPADVWSVGCMLYTLLVGR 210
            ::..|.:|:.|||||.:|:..:.|..|:||||||:||||:::..||..:|:|::||::||:|:||
Human   213 INEAMELKVGDFGLAARLEPLEHRRRTICGTPNYLSPEVLNKQGHGCESDIWALGCVMYTMLLGR 277

  Fly   211 PPFETDAVQSTLNKVVMSEYIMPAHLSYEAQDLINKLLKKLPHERITLEAVLCHPFMLK------ 269
            |||||..::.|...:..:.|.||:.|...|:.||..:|.|.|.:|.:|:.::.|.|.|:      
Human   278 PPFETTNLKETYRCIREARYTMPSSLLAPAKHLIASMLSKNPEDRPSLDDIIRHDFFLQGFTPDR 342

  Fly   270 -CSNGGHSAPG------ALNVFSQ---SMESGDSGIITFASSDSRNSQQIRSVENSGPQQVLPQI 324
             .|:..|:.|.      |.|.|.:   ::..|......:..:.:|.|::                
Human   343 LSSSCCHTVPDFHLSSPAKNFFKKAAAALFGGKKDKARYIDTHNRVSKE---------------- 391

  Fly   325 REEFKQVHHKLPYEQTGLFGQASTGLAEPNWPGAAKSSAFCMEAGNVPNSKQASLKEDRISVPPL 389
            .|:..::.|.|                                       |:.|:.:.       
Human   392 DEDIYKLRHDL---------------------------------------KKTSITQQ------- 410

  Fly   390 NTKRLLPTRYKTKNAIM----SILRNGEVVLEFLKFRPTYNEDRINDICR--------------- 435
                  |::::|...:.    ::.|:|...:|        |:.:|.|..|               
Human   411 ------PSKHRTDEELQPPTTTVARSGTPAVE--------NKQQIGDAIRMIVRGTLGSCSSSSE 461

  Fly   436 ---------ISDDGQRIIIYQPDPGRGLPVREQPPDLQ-IPSGDCVYNYDNLPSKHW-------- 482
                     ::|...|::       ||.        |: :|..||:.......|..|        
Human   462 CLEDSTMGSVADTVARVL-------RGC--------LENMPEADCIPKEQLSTSFQWVTKWVDYS 511

  Fly   483 KKYIYGARF----VG-----------LVKSKTPKVTYFSTLGKCQLMETMTDFEIRFYSGAKLLK 532
            .||.:|.:.    ||           |...||  |.|::.||:|.:... ||...:|.|...:||
Human   512 NKYGFGYQLSDHTVGVLFNNGAHMSLLPDKKT--VHYYAELGQCSVFPA-TDAPEQFISQVTVLK 573

  Fly   533  532
            Human   574  573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SAKNP_649324.1 STKc_PLK4 12..267 CDD:271088 96/250 (38%)
S_TKc 14..267 CDD:214567 96/250 (38%)
POLO_box_Plk4_1 382..497 CDD:240557 25/166 (15%)
POLO_box_Plk4_2 498..596 CDD:240558 13/35 (37%)
POLO_box_Plk4_3 657..738 CDD:240559
PLK2NP_006613.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..70
STKc_PLK2 80..334 CDD:271090 96/250 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 406..433 5/39 (13%)
POLO_box_1 503..588 CDD:240561 20/74 (27%)
POLO_box_2 601..682 CDD:240560
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0575
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D507604at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.