DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SAK and plk2a

DIOPT Version :9

Sequence 1:NP_649324.1 Gene:SAK / 40384 FlyBaseID:FBgn0026371 Length:769 Species:Drosophila melanogaster
Sequence 2:XP_003199325.1 Gene:plk2a / 100148413 ZFINID:ZDB-GENE-060810-71 Length:678 Species:Danio rerio


Alignment Length:582 Identity:154/582 - (26%)
Similarity:242/582 - (41%) Gaps:159/582 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLGKGGFATVYKARCLHTHQDVAIKMIDKKLIQGTGLTNRVRQEVEIHSRLKHPSVLQLYTFFQD 83
            :|||||||..|:...|.|.:..|.|:|....:.......::.:|:|:|..|.|..::|.|..|:|
Zfish    66 VLGKGGFAKCYEFTDLSTGKMYAAKIIPHTRVSKPHQREKIDREIELHRALHHKHIVQFYHHFED 130

  Fly    84 ANYVYLVLELAHNGELHRYMNHIARP---FTETEAASILKQVVAGLLYLHSHNIMHRDISLSNLL 145
            .:.:|::||...    .|.:.||.:.   .||.|....|||:|:||.|||...|:|||:.|.|..
Zfish   131 KDNIYILLEYCS----RRSLAHILKARKVLTEPEVRYYLKQIVSGLKYLHEQEILHRDLKLGNFF 191

  Fly   146 LSREMHVKIADFGLATQLKRPDERHMTMCGTPNYISPEVVSRTSHGLPADVWSVGCMLYTLLVGR 210
            ::..|.:|:.|||||.:|:..:.|..|:||||||:||||:::..||..:|||::||::||:|:||
Zfish   192 INEFMELKVGDFGLAAKLEPLENRRRTICGTPNYLSPEVLNKQGHGCESDVWALGCVMYTMLLGR 256

  Fly   211 PPFETDAVQSTLNKVVMSEYIMPAHLSYEAQDLINKLLKKLPHERITLEAVLCHPFMLK------ 269
            |||||..::.|...:..:.|..|:.||.:|:.||:.:|.|.|.:|..|..:|.|.|..:      
Zfish   257 PPFETTNLKETYRCIREARYSTPSSLSPQAKHLISSMLAKNPVDRPQLCDILRHDFFCQGFTPDR 321

  Fly   270 -CSNGGHSAPGALNVFSQSMESGDSGIITFASSDSRNSQQIRSVENSGPQQVLPQIREEFKQVHH 333
             .:|..|:||                                                   .:||
Zfish   322 LSANCCHAAP---------------------------------------------------DIHH 335

  Fly   334 KLPYEQTGLFGQASTGLAEPNWPGAAKSSAFCMEAGNVPNSKQASLKEDRI-------SVPPLNT 391
            ..|.:  ..|.:|:..|.     |..|..|..:|..|.|..::..:..:|:       ||.|   
Zfish   336 TSPAK--SFFKKAAATLF-----GGKKDKAKYLETRNKPAKEEEEININRLCIDLRKTSVSP--- 390

  Fly   392 KRLLPTRYKTKNAIMSILRNGE-VVLEFLKFRPTYNEDRINDICRISDDGQRIIIYQPDPGRGLP 455
               .|.|...:|...||...|: .||.    :...::..|.|..|                  :.
Zfish   391 ---QPCRQTLENNKPSIPSAGKPAVLT----KDASSKQHIRDSIR------------------MI 430

  Fly   456 VREQPPDLQIPSGDCVYN-----------------YDNL------------PSKHW--------K 483
            ||.........|.:|:.|                 .:|:            .|..|        .
Zfish   431 VRGTLRSCSSSSSECLENCTVGSVADTVARVLQGCLENMSEANNISKESMNSSFQWVTKWVDYSN 495

  Fly   484 KYIYGARF----VGL---------VKSKTPKVTYFSTLGKCQLMETMTDFEIRFYSGAKLLK 532
            ||.:|.:.    ||:         :.|....|.|::.||:|.:..| ::...:|...|.:||
Zfish   496 KYGFGYQLSDHTVGVLFNNGTHMSLLSDKKTVHYYAELGQCSVFLT-SEAPEQFVGQATILK 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SAKNP_649324.1 STKc_PLK4 12..267 CDD:271088 98/250 (39%)
S_TKc 14..267 CDD:214567 98/250 (39%)
POLO_box_Plk4_1 382..497 CDD:240557 28/172 (16%)
POLO_box_Plk4_2 498..596 CDD:240558 10/35 (29%)
POLO_box_Plk4_3 657..738 CDD:240559
plk2aXP_003199325.1 PKc_like 59..313 CDD:304357 98/250 (39%)
S_TKc 61..313 CDD:214567 98/250 (39%)
POLO_box_1 486..571 CDD:240561 17/72 (24%)
POLO_box_2 584..665 CDD:240560
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0575
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D507604at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.