DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SAK and pimr52

DIOPT Version :9

Sequence 1:NP_649324.1 Gene:SAK / 40384 FlyBaseID:FBgn0026371 Length:769 Species:Drosophila melanogaster
Sequence 2:XP_021333990.1 Gene:pimr52 / 100006411 ZFINID:ZDB-GENE-070912-460 Length:336 Species:Danio rerio


Alignment Length:252 Identity:75/252 - (29%)
Similarity:107/252 - (42%) Gaps:44/252 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EDYEVQHLLGKGGFATVYKARCLHTHQDVAIKMIDKK------LIQGTGLTNRVRQEVEIHSRLK 70
            :.|....|||:|||.:|:..........||||.:.|:      .:.|.|   |:..||.:.:|:.
Zfish    78 DQYAKGPLLGRGGFGSVFAGIRRSDGLPVAIKYVSKEPTDTRLKVDGQG---RLPLEVALMTRVS 139

  Fly    71 H----PSVLQLYTFFQDANYVYLVLE-----------LAHNGELHRYMNHIARPFTETEAASILK 120
            .    ||||||..:|.......|:||           ...||.|           .|..|..:|.
Zfish   140 SAPVCPSVLQLLDWFDHRRRYVLILERPAPCQDLQSFCEENGCL-----------DEPLAKKVLV 193

  Fly   121 QVVAGLLYLHSHNIMHRDISLSNLLLSREMH-VKIADFGLATQLKRPDERHMTMCGTPNYISPE- 183
            |::|.|.:..|..::|||:...|||:|.:.| :|:.|||....:|  |..:....|||.:..|| 
Zfish   194 QLIAALKHCESRRVLHRDVKPENLLISTDSHDIKLLDFGCGDLMK--DSAYRYFAGTPAFAPPEW 256

  Fly   184 VVSRTSHGLPADVWSVGCMLYTLLVGRPPFETDAVQSTLNKVVMSEYIMPAHLSYEA 240
            ......|..|..|||:|..||.:|....||.  ..:...:|   |....|..||.:|
Zfish   257 FRHHRYHASPLTVWSIGVTLYNILCDCFPFR--GARRVTSK---SRLHFPRKLSTDA 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SAKNP_649324.1 STKc_PLK4 12..267 CDD:271088 75/252 (30%)
S_TKc 14..267 CDD:214567 75/250 (30%)
POLO_box_Plk4_1 382..497 CDD:240557
POLO_box_Plk4_2 498..596 CDD:240558
POLO_box_Plk4_3 657..738 CDD:240559
pimr52XP_021333990.1 PKc_like 79..308 CDD:328722 74/249 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.