DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment M6 and Plp1

DIOPT Version :9

Sequence 1:NP_001262166.1 Gene:M6 / 40383 FlyBaseID:FBgn0037092 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_112252.1 Gene:Plp1 / 24943 RGDID:3354 Length:277 Species:Rattus norvegicus


Alignment Length:280 Identity:67/280 - (23%)
Similarity:110/280 - (39%) Gaps:76/280 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 ECCQSCMARIPYATLIATLMCLLGVGIFCFTMYRGASLTVIMVD-------QVFHLRLIWIEAVQ 180
            |||..|:...|:|:|:||.:|..||.:||...:...:.|..:::       |.:...:..|.|.|
  Rat     5 ECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQ 69

  Fly   181 MIFVIIGAG--MAALGFMILFVGFLATGATRYKVYRAWRSRVGGR-ISCAV-------------- 228
              :||.|..  ....|.::|..||..|||.| :::..:::.:.|: :|..|              
  Rat    70 --YVIYGTASFFFLYGALLLAEGFYTTGAVR-QIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQ 131

  Fly   229 --------------------LMGITYLLNFVWSLILCFLVVVTFIYTMFWNMC--------TSVE 265
                                .:||||.|..||.|:.....|..:||...|..|        ||..
  Rat   132 AHSLERVCHCLGKWLGHPDKFVGITYALTVVWLLVFACSAVPVYIYFNTWTTCQSIAFPSKTSAS 196

  Fly   266 HSQSCIDLTQFHFM----FPPNTKLEDMKVCEKYEIKAFCKDGVENAEV-----MFILATLSTLL 321
            ....|.|...:..:    ||.       |||.. .:.:.||    .||.     :||.|.:....
  Rat   197 IGSLCADARMYGVLPWNAFPG-------KVCGS-NLLSICK----TAEFQMTFHLFIAAFVGAAA 249

  Fly   322 VLLSLVHYLMCLSANYAHIR 341
            .|:||:.:::..:.|:|.::
  Rat   250 TLVSLLTFMIAATYNFAVLK 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
M6NP_001262166.1 Myelin_PLP 123..345 CDD:279599 67/280 (24%)
Plp1NP_112252.1 Myelin_PLP 5..273 CDD:396024 67/280 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336056
Domainoid 1 1.000 106 1.000 Domainoid score I6439
eggNOG 1 0.900 - - E1_KOG4800
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 114 1.000 Inparanoid score I4745
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D390385at33208
OrthoFinder 1 1.000 - - FOG0001336
OrthoInspector 1 1.000 - - otm45124
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11683
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.