DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Est-Q and LOC107987423

DIOPT Version :9

Sequence 1:NP_649321.1 Gene:Est-Q / 40381 FlyBaseID:FBgn0037090 Length:559 Species:Drosophila melanogaster
Sequence 2:XP_016885725.1 Gene:LOC107987423 / 107987423 -ID:- Length:286 Species:Homo sapiens


Alignment Length:254 Identity:43/254 - (16%)
Similarity:98/254 - (38%) Gaps:57/254 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 LVKCIQKAKVIDILKATASESF------------SPIVGD-LHGILPQQPSELVKSYR--RQIPI 337
            :|.|:::....::|:.|....|            .|::|. :.|:|..:..|.:::.|  ..:|.
Human     1 MVHCLRQKTEEELLETTLKMKFLSLDLQGDPRESQPLLGTVIDGMLLLKTPEELQAERNFHTVPY 65

  Fly   338 LTGFTQHDGSFVLASY---YDALAAKVANVSSLSVRQFSQGI----NDLVNDTS-----GLTDNI 390
            :.|..:.:..:::...   |.....::...:::|:...|..:    .:|:.:.:     |..|.:
Human    66 MVGINKQEFGWLIPMQLMSYPLSEGQLDQKTAMSLLWKSYPLVCIAKELIPEATEKYLGGTDDTV 130

  Fly   391 LNRLLFKPQALNSHDHSAAVSSYFDLTTNIFMKSPVITLATKMYTQQRSTPVYVYSFEYEGTYTR 455
            ..:.||                 .||..::....|.:.:|..  .:....|.|:|.|:|..:   
Human   131 KKKDLF-----------------LDLIADVMFGVPSVIVARN--HRDAGAPTYMYEFQYRPS--- 173

  Fly   456 FGYEFGNSHYPFNGGVHHSNDNIYLFATHPL-EG---QDTQMSQKMVDVWTSFAIEGVP 510
                |.:...|......|.::...:|....| ||   ::.::|:.::..|.:||..|.|
Human   174 ----FSSDMKPKTVIGDHGDELFSVFGAPFLKEGASEEEIRLSKMVMKFWANFARNGNP 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Est-QNP_649321.1 COesterase 39..544 CDD:278561 43/254 (17%)
Aes <137..>240 CDD:223730
LOC107987423XP_016885725.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D206516at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.