DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr78 and Hr83

DIOPT Version :9

Sequence 1:NP_001189151.1 Gene:Hr78 / 40378 FlyBaseID:FBgn0015239 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster


Alignment Length:172 Identity:56/172 - (32%)
Similarity:80/172 - (46%) Gaps:43/172 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 CLVCGDRASGRHYGAISCEGCKGFFKRSIRKQLGYQCRGAM-NCEVTKHHRNRCQFCRLQKCLAS 115
            |.||||::||:|||...|:||..|||||:|:...|.|...: ||.|.|..||.|..||.|:|||.
  Fly     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALVGNCVVDKARRNWCPSCRFQRCLAV 71

  Fly   116 GMRSDSVQHERKPIVDRKEGIIAAAGSSSTSGGGNGSSTYLSGKSGYQQGRGKGHSVKAESAATP 180
            ||.:.:||.||.|   |.:.:..                       |:.||.:  :..:::|.:|
  Fly    72 GMNAAAVQEERGP---RNQQVAL-----------------------YRTGRRQ--APPSQAAPSP 108

  Fly   181 PVHSAPATAFNLNENIFPMGLNFAELTQTLMFATQQQQQQQQ 222
            ..||              ..|:|..|.|.|:...:|.:..:|
  Fly   109 TPHS--------------QALHFQILAQILVTCLRQAKANEQ 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr78NP_001189151.1 NR_DBD_TR2_like 47..133 CDD:143525 41/81 (51%)
NR_LBD_TR2_like 372..595 CDD:132750
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 42/83 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444777
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24083
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.