DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7519 and YPL225W

DIOPT Version :9

Sequence 1:NP_649318.1 Gene:CG7519 / 40377 FlyBaseID:FBgn0037087 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_015099.1 Gene:YPL225W / 855876 SGDID:S000006146 Length:146 Species:Saccharomyces cerevisiae


Alignment Length:135 Identity:60/135 - (44%)
Similarity:88/135 - (65%) Gaps:5/135 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AEEFGNDTLVEEMWAAKALEHAEVHFNLITSVHPSQLKLTPYDDQIYATFRQDFPDL----HVGR 74
            ||...|...:|:.:|..|:|.||.::.|:|||..|:|:||.:||:||..|.:.||:.    .|.:
Yeast     6 AETADNLEDIEKQFAVVAVEQAETYWKLLTSVPGSKLRLTKFDDEIYENFMERFPEYKDVERVKK 70

  Fly    75 LTDDILKSATAKLKWRQFAEKF-NKLDDYSYGTLMRADASREFSPDNSIFVFRVQFLAIEIARNR 138
            .|::.||:..||.:||:|...| .|::||::|||:|.|||.|:....:.||.|:||.|.|||||:
Yeast    71 FTEEELKTKEAKERWRKFFTIFEKKIEDYNFGTLLRTDASAEYGQFTTCFVVRLQFYAFEIARNK 135

  Fly   139 EGLND 143
            .||||
Yeast   136 HGLND 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7519NP_649318.1 Polysacc_synt_4 23..147 CDD:282517 57/126 (45%)
YPL225WNP_015099.1 Polysacc_synt_4 15..142 CDD:368048 57/126 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346789
Domainoid 1 1.000 106 1.000 Domainoid score I1451
eggNOG 1 0.900 - - E1_KOG4093
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9542
Inparanoid 1 1.050 113 1.000 Inparanoid score I1359
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52839
OrthoFinder 1 1.000 - - FOG0005721
OrthoInspector 1 1.000 - - oto99388
orthoMCL 1 0.900 - - OOG6_105428
Panther 1 1.100 - - LDO PTHR13410
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1875
SonicParanoid 1 1.000 - - X4120
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.