DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7519 and Pbdc1

DIOPT Version :9

Sequence 1:NP_649318.1 Gene:CG7519 / 40377 FlyBaseID:FBgn0037087 Length:160 Species:Drosophila melanogaster
Sequence 2:XP_006528328.1 Gene:Pbdc1 / 67683 MGIID:1914933 Length:241 Species:Mus musculus


Alignment Length:123 Identity:60/123 - (48%)
Similarity:82/123 - (66%) Gaps:1/123 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EMMHGASLLSRPAEEFGNDTLVEEMWAAKALEHAEVHFNLITSVHPSQLKLTPYDDQIYATFRQD 66
            |.:..|..||.|.|.:|||..:|..||.:|::||||::.||:||.|..||||..|||||:.||:.
Mouse    14 EALSIAHALSHPPESYGNDPDIEMAWAIRAMQHAEVYYKLISSVDPQFLKLTKVDDQIYSEFREI 78

  Fly    67 FPDLHVGRLTDDILKSATAKLKWRQFAEKFNKL-DDYSYGTLMRADASREFSPDNSIF 123
            |..|.|..|..:.|||.:||.|||.|..||..: :||:||||:|.|.|:.::.:|:||
Mouse    79 FETLRVDVLDPEELKSESAKEKWRPFCLKFEGIVEDYNYGTLLRLDCSQGYTEENTIF 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7519NP_649318.1 Polysacc_synt_4 23..147 CDD:282517 51/102 (50%)
Pbdc1XP_006528328.1 Polysacc_synt_4 35..136 CDD:383809 49/100 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850781
Domainoid 1 1.000 126 1.000 Domainoid score I5420
eggNOG 1 0.900 - - E1_KOG4093
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9542
Inparanoid 1 1.050 143 1.000 Inparanoid score I4445
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52839
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005721
OrthoInspector 1 1.000 - - oto92976
orthoMCL 1 0.900 - - OOG6_105428
Panther 1 1.100 - - LDO PTHR13410
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1875
SonicParanoid 1 1.000 - - X4120
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.