DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7519 and Y54E5A.5

DIOPT Version :9

Sequence 1:NP_649318.1 Gene:CG7519 / 40377 FlyBaseID:FBgn0037087 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_493553.1 Gene:Y54E5A.5 / 173330 WormBaseID:WBGene00013200 Length:153 Species:Caenorhabditis elegans


Alignment Length:141 Identity:67/141 - (47%)
Similarity:91/141 - (64%) Gaps:4/141 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AEEFGNDTLVEEMWAAKALEHAEVHFNLITSVHPSQLKLTPYDDQIYATFRQDFPDLHVGRLTDD 78
            |:::.||..:|..||.||.|.:|||.|||.......|:|..:.|.|.|.||..||||:|..:|..
 Worm     7 ADKYVNDESIEMAWAIKAGERSEVHMNLIMRCDTRVLRLNKHQDAILAAFRSSFPDLNVEEVTTS 71

  Fly    79 ILKSATAKLKWRQFAEKFNKL-DDYSYGTLMRADASREFSPDNSIFVFRVQFLAIEIARNREGLN 142
            :||...||..||:|.|:|..: ||||.|||||..||:.:||:|::.|.|:.:||||:|||.||:|
 Worm    72 LLKDGGAKETWREFCEQFKDIVDDYSMGTLMRIHASKAYSPENTVVVPRIIYLAIEMARNVEGVN 136

  Fly   143 D---EAYEKHK 150
            :   |||..|:
 Worm   137 EKNKEAYTAHR 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7519NP_649318.1 Polysacc_synt_4 23..147 CDD:282517 62/127 (49%)
Y54E5A.5NP_493553.1 Polysacc_synt_4 16..137 CDD:282517 59/120 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167874
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4093
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9542
Inparanoid 1 1.050 128 1.000 Inparanoid score I3244
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52839
OrthoDB 1 1.010 - - D1420225at2759
OrthoFinder 1 1.000 - - FOG0005721
OrthoInspector 1 1.000 - - oto19345
orthoMCL 1 0.900 - - OOG6_105428
Panther 1 1.100 - - LDO PTHR13410
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1875
SonicParanoid 1 1.000 - - X4120
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.